BLASTX nr result
ID: Aconitum21_contig00019765
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00019765 (415 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532033.1| conserved hypothetical protein [Ricinus comm... 61 1e-07 ref|XP_002302043.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 ref|XP_002306853.1| predicted protein [Populus trichocarpa] gi|2... 58 9e-07 emb|CBI37126.3| unnamed protein product [Vitis vinifera] 56 3e-06 ref|XP_002277984.1| PREDICTED: SAP-like protein BP-73-like [Viti... 56 3e-06 >ref|XP_002532033.1| conserved hypothetical protein [Ricinus communis] gi|223528303|gb|EEF30349.1| conserved hypothetical protein [Ricinus communis] Length = 385 Score = 60.8 bits (146), Expect = 1e-07 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 216 LKLPELRALAKSRGVKGFYKLKKGELVALLSGDSV 320 LKLPELRALAKSRG+KGF K+KKG+LV LLSGDSV Sbjct: 351 LKLPELRALAKSRGLKGFSKMKKGDLVELLSGDSV 385 >ref|XP_002302043.1| predicted protein [Populus trichocarpa] gi|222843769|gb|EEE81316.1| predicted protein [Populus trichocarpa] Length = 389 Score = 59.7 bits (143), Expect = 2e-07 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +3 Query: 216 LKLPELRALAKSRGVKGFYKLKKGELVALLSGDSV 320 LKLPELRALAKSRGVKGF K+KKGELV LLSG S+ Sbjct: 355 LKLPELRALAKSRGVKGFSKMKKGELVELLSGSSM 389 >ref|XP_002306853.1| predicted protein [Populus trichocarpa] gi|222856302|gb|EEE93849.1| predicted protein [Populus trichocarpa] Length = 389 Score = 57.8 bits (138), Expect = 9e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +3 Query: 216 LKLPELRALAKSRGVKGFYKLKKGELVALLSGDSV 320 LKLPELR LAKS+GVKGF K+KKGELV LLSG SV Sbjct: 355 LKLPELRVLAKSQGVKGFSKMKKGELVELLSGSSV 389 >emb|CBI37126.3| unnamed protein product [Vitis vinifera] Length = 351 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +3 Query: 216 LKLPELRALAKSRGVKGFYKLKKGELVALLSGDSV 320 LKLPELRALAKSRG+KGF KLKKGEL+ LL G S+ Sbjct: 317 LKLPELRALAKSRGMKGFSKLKKGELMELLIGRSI 351 >ref|XP_002277984.1| PREDICTED: SAP-like protein BP-73-like [Vitis vinifera] Length = 377 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +3 Query: 216 LKLPELRALAKSRGVKGFYKLKKGELVALLSGDSV 320 LKLPELRALAKSRG+KGF KLKKGEL+ LL G S+ Sbjct: 343 LKLPELRALAKSRGMKGFSKLKKGELMELLIGRSI 377