BLASTX nr result
ID: Aconitum21_contig00019713
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00019713 (426 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004155787.1| PREDICTED: UDP-glucuronate 4-epimerase 3-lik... 74 2e-11 ref|XP_004133919.1| PREDICTED: UDP-glucuronate 4-epimerase 3-lik... 74 2e-11 ref|NP_171702.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis th... 74 2e-11 ref|NP_191922.1| UDP-D-glucuronate 4-epimerase 3 [Arabidopsis th... 74 2e-11 ref|XP_002892033.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis... 74 2e-11 >ref|XP_004155787.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cucumis sativus] Length = 432 Score = 73.6 bits (179), Expect = 2e-11 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = +2 Query: 2 SVYGLNTDVPFSEKDRTDQPASLYAATKKVGEEIAHT 112 SVYGLNT VPFSEKDRTDQPASLYAATKK GEEIAHT Sbjct: 221 SVYGLNTKVPFSEKDRTDQPASLYAATKKAGEEIAHT 257 >ref|XP_004133919.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cucumis sativus] Length = 438 Score = 73.6 bits (179), Expect = 2e-11 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = +2 Query: 2 SVYGLNTDVPFSEKDRTDQPASLYAATKKVGEEIAHT 112 SVYGLNT VPFSEKDRTDQPASLYAATKK GEEIAHT Sbjct: 227 SVYGLNTKVPFSEKDRTDQPASLYAATKKAGEEIAHT 263 >ref|NP_171702.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis thaliana] gi|75264107|sp|Q9LPC1.1|GAE2_ARATH RecName: Full=UDP-glucuronate 4-epimerase 2; AltName: Full=UDP-glucuronic acid epimerase 2 gi|8570451|gb|AAF76478.1|AC020622_12 Contains similarity to CAPI protein from Staphylococcus aureus gi|P39858 and contains a NAD dependent epimerase/dehydratase PF|01370 domain. ESTs gb|N97076, gb|AI997010 come from this gene [Arabidopsis thaliana] gi|12248041|gb|AAG50112.1|AF334734_1 putative nucleotide sugar epimerase [Arabidopsis thaliana] gi|332189243|gb|AEE27364.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis thaliana] Length = 434 Score = 73.6 bits (179), Expect = 2e-11 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = +2 Query: 2 SVYGLNTDVPFSEKDRTDQPASLYAATKKVGEEIAHT 112 SVYGLNT VPFSEKDRTDQPASLYAATKK GEEIAHT Sbjct: 220 SVYGLNTKVPFSEKDRTDQPASLYAATKKAGEEIAHT 256 >ref|NP_191922.1| UDP-D-glucuronate 4-epimerase 3 [Arabidopsis thaliana] gi|75100157|sp|O81312.1|GAE3_ARATH RecName: Full=UDP-glucuronate 4-epimerase 3; AltName: Full=UDP-glucuronic acid epimerase 3 gi|3193316|gb|AAC19298.1| contains similarity to nucleotide sugar epimerases [Arabidopsis thaliana] gi|7267098|emb|CAB80769.1| putative nucleotide sugar epimerase [Arabidopsis thaliana] gi|111074442|gb|ABH04594.1| At4g00110 [Arabidopsis thaliana] gi|332656424|gb|AEE81824.1| UDP-D-glucuronate 4-epimerase 3 [Arabidopsis thaliana] Length = 430 Score = 73.6 bits (179), Expect = 2e-11 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = +2 Query: 2 SVYGLNTDVPFSEKDRTDQPASLYAATKKVGEEIAHT 112 SVYGLNT VPFSEKDRTDQPASLYAATKK GEEIAHT Sbjct: 219 SVYGLNTKVPFSEKDRTDQPASLYAATKKAGEEIAHT 255 >ref|XP_002892033.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata] gi|297337875|gb|EFH68292.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata] Length = 434 Score = 73.6 bits (179), Expect = 2e-11 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = +2 Query: 2 SVYGLNTDVPFSEKDRTDQPASLYAATKKVGEEIAHT 112 SVYGLNT VPFSEKDRTDQPASLYAATKK GEEIAHT Sbjct: 220 SVYGLNTKVPFSEKDRTDQPASLYAATKKAGEEIAHT 256