BLASTX nr result
ID: Aconitum21_contig00019605
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00019605 (479 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABY60887.1| carotenoid cleavage dioxygenase 4 [Osmanthus frag... 80 2e-13 gb|AEI61930.1| carotenoid cleavage dioxygenase 4 [Nicotiana taba... 79 4e-13 ref|XP_003612461.1| 50S ribosomal protein L14 [Medicago truncatu... 77 1e-12 ref|XP_003516508.1| PREDICTED: probable carotenoid cleavage diox... 77 1e-12 ref|XP_002307055.1| predicted protein [Populus trichocarpa] gi|2... 77 1e-12 >gb|ABY60887.1| carotenoid cleavage dioxygenase 4 [Osmanthus fragrans] Length = 609 Score = 79.7 bits (195), Expect = 2e-13 Identities = 36/55 (65%), Positives = 45/55 (81%), Gaps = 3/55 (5%) Frame = -3 Query: 159 KNRPSSPTSL---LFNIMDEVVNTFIDPPLRPSVDPKHVLSNNFAPVYELPPTEC 4 K RP+ P SL +FN++D +NTF+DPPLRPSVDP++VLS+NFAPV ELPPT C Sbjct: 88 KTRPTEPVSLPTTIFNVVDGFINTFVDPPLRPSVDPRYVLSDNFAPVDELPPTLC 142 >gb|AEI61930.1| carotenoid cleavage dioxygenase 4 [Nicotiana tabacum] Length = 601 Score = 79.0 bits (193), Expect = 4e-13 Identities = 36/49 (73%), Positives = 42/49 (85%) Frame = -3 Query: 150 PSSPTSLLFNIMDEVVNTFIDPPLRPSVDPKHVLSNNFAPVYELPPTEC 4 PS P S++FN D+ VNTFIDPPL+P VDPK++LSNNFAPV ELPPTEC Sbjct: 89 PSFP-SVIFNAFDDFVNTFIDPPLKPCVDPKYILSNNFAPVDELPPTEC 136 >ref|XP_003612461.1| 50S ribosomal protein L14 [Medicago truncatula] gi|355513796|gb|AES95419.1| 50S ribosomal protein L14 [Medicago truncatula] Length = 696 Score = 77.4 bits (189), Expect = 1e-12 Identities = 35/53 (66%), Positives = 44/53 (83%), Gaps = 1/53 (1%) Frame = -3 Query: 159 KNRPSSPTSLLFNIMDEVVNTFIDPPLRPSVDPKHVLSNNFAPVY-ELPPTEC 4 K + SS +LLFN D+++NTFIDPP++PSVDP+HVLS NFAPV ELPPT+C Sbjct: 67 KPQTSSLPALLFNTFDDIINTFIDPPIKPSVDPRHVLSQNFAPVLDELPPTQC 119 >ref|XP_003516508.1| PREDICTED: probable carotenoid cleavage dioxygenase 4, chloroplastic-like [Glycine max] Length = 590 Score = 77.0 bits (188), Expect = 1e-12 Identities = 30/44 (68%), Positives = 39/44 (88%) Frame = -3 Query: 135 SLLFNIMDEVVNTFIDPPLRPSVDPKHVLSNNFAPVYELPPTEC 4 +L+ N D+++N FIDPPL+PS+DP+HVLS NFAPV+ELPPTEC Sbjct: 80 ALMLNAFDDIINNFIDPPLKPSIDPRHVLSQNFAPVHELPPTEC 123 >ref|XP_002307055.1| predicted protein [Populus trichocarpa] gi|222856504|gb|EEE94051.1| predicted protein [Populus trichocarpa] Length = 507 Score = 77.0 bits (188), Expect = 1e-12 Identities = 31/43 (72%), Positives = 41/43 (95%) Frame = -3 Query: 132 LLFNIMDEVVNTFIDPPLRPSVDPKHVLSNNFAPVYELPPTEC 4 ++FN++++V+N FIDPPLRPSVDP++VLS+NFAPV ELPPTEC Sbjct: 1 MMFNVLEDVINNFIDPPLRPSVDPRYVLSDNFAPVDELPPTEC 43