BLASTX nr result
ID: Aconitum21_contig00019090
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00019090 (496 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002328897.1| predicted protein [Populus trichocarpa] gi|2... 70 1e-10 ref|NP_001242538.1| uncharacterized protein LOC100787107 [Glycin... 69 5e-10 ref|XP_004172868.1| PREDICTED: uncharacterized protein LOC101231... 68 9e-10 ref|XP_004133990.1| PREDICTED: alkaline ceramidase 3-like [Cucum... 68 9e-10 ref|XP_002518057.1| alkaline phytoceramidase, putative [Ricinus ... 68 9e-10 >ref|XP_002328897.1| predicted protein [Populus trichocarpa] gi|222839327|gb|EEE77664.1| predicted protein [Populus trichocarpa] Length = 158 Score = 70.5 bits (171), Expect = 1e-10 Identities = 32/40 (80%), Positives = 35/40 (87%), Gaps = 1/40 (2%) Frame = -1 Query: 496 SYFANAFLMFCRAQQLGWAPRVVLYMG-FPYVKVQKPKTQ 380 SYFAN FLMFCRAQQLGW P+V +MG FPYVK+QKPKTQ Sbjct: 119 SYFANTFLMFCRAQQLGWNPKVAHFMGFFPYVKIQKPKTQ 158 >ref|NP_001242538.1| uncharacterized protein LOC100787107 [Glycine max] gi|255639818|gb|ACU20202.1| unknown [Glycine max] Length = 254 Score = 68.6 bits (166), Expect = 5e-10 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -1 Query: 496 SYFANAFLMFCRAQQLGWAPRVVLYMGFPYVKVQKPKTQ 380 SYFAN FLMFCRAQQ GW+P+VV MG PYVK++KPK+Q Sbjct: 216 SYFANTFLMFCRAQQRGWSPKVVHLMGVPYVKIEKPKSQ 254 >ref|XP_004172868.1| PREDICTED: uncharacterized protein LOC101231942, partial [Cucumis sativus] Length = 198 Score = 67.8 bits (164), Expect = 9e-10 Identities = 32/40 (80%), Positives = 35/40 (87%), Gaps = 1/40 (2%) Frame = -1 Query: 496 SYFANAFLMFCRAQQLGWAPRVVLYMG-FPYVKVQKPKTQ 380 SYFAN FLMFCRAQQL W PRVV ++G FPYVKVQKPK+Q Sbjct: 159 SYFANTFLMFCRAQQLEWNPRVVHFLGLFPYVKVQKPKSQ 198 >ref|XP_004133990.1| PREDICTED: alkaline ceramidase 3-like [Cucumis sativus] Length = 254 Score = 67.8 bits (164), Expect = 9e-10 Identities = 32/40 (80%), Positives = 35/40 (87%), Gaps = 1/40 (2%) Frame = -1 Query: 496 SYFANAFLMFCRAQQLGWAPRVVLYMG-FPYVKVQKPKTQ 380 SYFAN FLMFCRAQQL W PRVV ++G FPYVKVQKPK+Q Sbjct: 215 SYFANTFLMFCRAQQLEWNPRVVHFLGLFPYVKVQKPKSQ 254 >ref|XP_002518057.1| alkaline phytoceramidase, putative [Ricinus communis] gi|223542653|gb|EEF44190.1| alkaline phytoceramidase, putative [Ricinus communis] Length = 234 Score = 67.8 bits (164), Expect = 9e-10 Identities = 32/40 (80%), Positives = 35/40 (87%), Gaps = 1/40 (2%) Frame = -1 Query: 496 SYFANAFLMFCRAQQLGWAPRVVLYMG-FPYVKVQKPKTQ 380 SYFAN FLMFCRAQQLGW P+VV +G FPYVKV+KPKTQ Sbjct: 195 SYFANTFLMFCRAQQLGWNPKVVDLLGFFPYVKVRKPKTQ 234