BLASTX nr result
ID: Aconitum21_contig00018900
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00018900 (653 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAK61817.1| hypothetical protein [Citrus unshiu] 62 1e-07 >dbj|BAK61817.1| hypothetical protein [Citrus unshiu] Length = 179 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/54 (51%), Positives = 36/54 (66%), Gaps = 4/54 (7%) Frame = +2 Query: 143 WF----GFISVLLFGSMAEDQGREPTANLLCISECSTCPVICSPPPSQSSPAET 292 WF G ++++L G AEDQ P A LLCIS+C+TCPVICSPPP ++T Sbjct: 16 WFVLLMGMMTMMLKGVAAEDQTAGPAAGLLCISDCATCPVICSPPPPSPEESDT 69