BLASTX nr result
ID: Aconitum21_contig00018642
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00018642 (574 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACX37460.1| calcium dependent protein kinase 32 [Gossypium hi... 91 1e-16 gb|AEL88279.1| calcium-dependent protein kinase [Dimocarpus longan] 90 3e-16 ref|XP_002529620.1| calcium-dependent protein kinase, putative [... 90 3e-16 gb|AFR11232.1| calcium dependent protein kinase 3 [Chenopodium a... 88 1e-15 gb|AEI70328.1| calcium-dependent protein kinase [Hevea brasilien... 87 2e-15 >gb|ACX37460.1| calcium dependent protein kinase 32 [Gossypium hirsutum] Length = 550 Score = 90.9 bits (224), Expect = 1e-16 Identities = 45/63 (71%), Positives = 51/63 (80%) Frame = -1 Query: 574 GHISYEEFASMMKAGTDWRKASRQYSRDRFNNLSLKLMKDGSFQVNMNEGR*NT*NKHII 395 G ISY+EFA MMKAGTDWRKASRQYSR+RFNNLSLKLMKDGS Q+N R NT +K ++ Sbjct: 486 GRISYDEFAVMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSLQMNNEPRRPNTIDKVLL 545 Query: 394 CGN 386 N Sbjct: 546 MKN 548 >gb|AEL88279.1| calcium-dependent protein kinase [Dimocarpus longan] Length = 534 Score = 89.7 bits (221), Expect = 3e-16 Identities = 43/51 (84%), Positives = 48/51 (94%) Frame = -1 Query: 574 GHISYEEFASMMKAGTDWRKASRQYSRDRFNNLSLKLMKDGSFQVNMNEGR 422 G ISY+EFA+MMKAGTDWRKASRQYSR+RFNNLSLKLM+DGS Q+N NEGR Sbjct: 485 GRISYDEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMRDGSLQMN-NEGR 534 >ref|XP_002529620.1| calcium-dependent protein kinase, putative [Ricinus communis] gi|223530905|gb|EEF32765.1| calcium-dependent protein kinase, putative [Ricinus communis] Length = 529 Score = 89.7 bits (221), Expect = 3e-16 Identities = 44/51 (86%), Positives = 47/51 (92%) Frame = -1 Query: 574 GHISYEEFASMMKAGTDWRKASRQYSRDRFNNLSLKLMKDGSFQVNMNEGR 422 G ISY+EFA+MMKAGTDWRKASRQYSR+RFNNLSLKLMKDGS Q MNEGR Sbjct: 481 GRISYDEFATMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSLQ--MNEGR 529 >gb|AFR11232.1| calcium dependent protein kinase 3 [Chenopodium album] Length = 529 Score = 87.8 bits (216), Expect = 1e-15 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = -1 Query: 574 GHISYEEFASMMKAGTDWRKASRQYSRDRFNNLSLKLMKDGSFQVNMNEGR 422 G ISYEEFA+MMKAGTDWRKASRQYSR+RFNNLSLKL+KDGS Q + NEGR Sbjct: 480 GRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLIKDGSLQ-SANEGR 529 >gb|AEI70328.1| calcium-dependent protein kinase [Hevea brasiliensis] Length = 530 Score = 87.0 bits (214), Expect = 2e-15 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -1 Query: 574 GHISYEEFASMMKAGTDWRKASRQYSRDRFNNLSLKLMKDGSFQVN 437 G ISY+EFA+MMKAGTDWRKASRQYSR+RFNNLSLKLMKDGS Q+N Sbjct: 482 GRISYDEFATMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSLQMN 527