BLASTX nr result
ID: Aconitum21_contig00018512
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00018512 (434 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513118.1| Cytokinin dehydrogenase, putative [Ricinus c... 55 6e-06 >ref|XP_002513118.1| Cytokinin dehydrogenase, putative [Ricinus communis] gi|223548129|gb|EEF49621.1| Cytokinin dehydrogenase, putative [Ricinus communis] Length = 530 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/45 (55%), Positives = 31/45 (68%) Frame = -2 Query: 253 GG*WEEYPSAVLHPNLVLDIAKTVKHVCQQGPYSDLTIATRGDDH 119 G ++ P AVLHP V DIA T+KH+ Q GP+SDLT+A RG H Sbjct: 65 GNRFQLLPFAVLHPRSVSDIATTIKHIWQMGPHSDLTVAARGHGH 109