BLASTX nr result
ID: Aconitum21_contig00018133
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00018133 (427 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADD54592.1| putative zinc finger protein [Linum usitatissimum] 85 7e-15 ref|NP_197366.1| ring finger and CHY zinc finger domain-containi... 85 7e-15 ref|XP_002871827.1| zinc finger family protein [Arabidopsis lyra... 84 9e-15 ref|XP_004134192.1| PREDICTED: RING finger and CHY zinc finger d... 84 2e-14 ref|XP_002516875.1| zinc finger protein, putative [Ricinus commu... 82 3e-14 >gb|ADD54592.1| putative zinc finger protein [Linum usitatissimum] Length = 109 Score = 84.7 bits (208), Expect = 7e-15 Identities = 39/55 (70%), Positives = 44/55 (80%) Frame = -1 Query: 427 LDTEIEATAMPEEYRDKKVVILCNDCNTTSEVPFHIFGLKCSQCEAYNTRRI*HP 263 LD EIEAT MPE+YR+KKV ILCNDCN T+EV FHI G KCS C++YNTR I P Sbjct: 50 LDEEIEATVMPEDYRNKKVWILCNDCNDTTEVYFHIIGQKCSHCKSYNTRTIQPP 104 >ref|NP_197366.1| ring finger and CHY zinc finger domain-containing protein 1 [Arabidopsis thaliana] gi|17381208|gb|AAL36416.1| unknown protein [Arabidopsis thaliana] gi|20465813|gb|AAM20011.1| unknown protein [Arabidopsis thaliana] gi|332005211|gb|AED92594.1| ring finger and CHY zinc finger domain-containing protein 1 [Arabidopsis thaliana] Length = 267 Score = 84.7 bits (208), Expect = 7e-15 Identities = 39/55 (70%), Positives = 42/55 (76%) Frame = -1 Query: 427 LDTEIEATAMPEEYRDKKVVILCNDCNTTSEVPFHIFGLKCSQCEAYNTRRI*HP 263 LD EIEATAMP +YRDKKV ILCNDCN T+EV FHI G KC C +YNTR I P Sbjct: 209 LDEEIEATAMPSDYRDKKVWILCNDCNDTTEVHFHIIGQKCGHCRSYNTRAIAPP 263 >ref|XP_002871827.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297317664|gb|EFH48086.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Length = 267 Score = 84.3 bits (207), Expect = 9e-15 Identities = 39/55 (70%), Positives = 42/55 (76%) Frame = -1 Query: 427 LDTEIEATAMPEEYRDKKVVILCNDCNTTSEVPFHIFGLKCSQCEAYNTRRI*HP 263 LD EIEATAMP +YRDKKV ILCNDCN T+EV FHI G KC C +YNTR I P Sbjct: 209 LDEEIEATAMPSDYRDKKVWILCNDCNDTTEVYFHIIGQKCGHCRSYNTRAIAPP 263 >ref|XP_004134192.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Cucumis sativus] gi|449495374|ref|XP_004159819.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Cucumis sativus] Length = 271 Score = 83.6 bits (205), Expect = 2e-14 Identities = 39/55 (70%), Positives = 42/55 (76%) Frame = -1 Query: 427 LDTEIEATAMPEEYRDKKVVILCNDCNTTSEVPFHIFGLKCSQCEAYNTRRI*HP 263 LD EIEAT MPEEYR KKV ILCNDCN T+EV FHI G KC C++YNTR I P Sbjct: 213 LDEEIEATVMPEEYRHKKVWILCNDCNDTTEVYFHIIGQKCCHCQSYNTRAIAPP 267 >ref|XP_002516875.1| zinc finger protein, putative [Ricinus communis] gi|223543963|gb|EEF45489.1| zinc finger protein, putative [Ricinus communis] Length = 269 Score = 82.4 bits (202), Expect = 3e-14 Identities = 38/55 (69%), Positives = 43/55 (78%) Frame = -1 Query: 427 LDTEIEATAMPEEYRDKKVVILCNDCNTTSEVPFHIFGLKCSQCEAYNTRRI*HP 263 +D EIEAT MPE+YR KKV ILCNDCN T+EV FHI G KCS C++YNTR I P Sbjct: 211 IDEEIEATVMPEDYRYKKVWILCNDCNDTTEVYFHIIGQKCSHCKSYNTRTIAPP 265