BLASTX nr result
ID: Aconitum21_contig00017689
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00017689 (404 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN69960.1| hypothetical protein VITISV_032887 [Vitis vinifera] 73 2e-11 ref|XP_002267809.2| PREDICTED: pentatricopeptide repeat-containi... 72 4e-11 ref|XP_003626687.1| Pentatricopeptide repeat-containing protein ... 65 5e-10 ref|XP_003595941.1| Pentatricopeptide repeat-containing protein ... 65 5e-10 gb|AAM62704.1| unknown [Arabidopsis thaliana] 65 6e-09 >emb|CAN69960.1| hypothetical protein VITISV_032887 [Vitis vinifera] Length = 472 Score = 73.2 bits (178), Expect = 2e-11 Identities = 36/61 (59%), Positives = 50/61 (81%) Frame = +3 Query: 222 IFHSPSLSDAKKTFDSILSTSHLPLEVRHHNTLLRSFAQISATVHDSFSFLQHMLKARPA 401 IF+SP+L DAKK F SI +TS PL++R HN LL+S++ IS TV+DS SFL+HM+K++P+ Sbjct: 68 IFNSPNLLDAKKLFASITTTSTTPLDLRFHNALLQSYSSIS-TVNDSISFLRHMIKSQPS 126 Query: 402 F 404 F Sbjct: 127 F 127 >ref|XP_002267809.2| PREDICTED: pentatricopeptide repeat-containing protein At2g17670-like [Vitis vinifera] Length = 458 Score = 72.4 bits (176), Expect = 4e-11 Identities = 36/61 (59%), Positives = 49/61 (80%) Frame = +3 Query: 222 IFHSPSLSDAKKTFDSILSTSHLPLEVRHHNTLLRSFAQISATVHDSFSFLQHMLKARPA 401 IF+SP+L DAKK F SI +TS PL+ R HN LL+S++ IS TV+DS SFL+HM+K++P+ Sbjct: 136 IFNSPNLLDAKKLFASITTTSTTPLDFRFHNALLQSYSSIS-TVNDSISFLRHMIKSQPS 194 Query: 402 F 404 F Sbjct: 195 F 195 >ref|XP_003626687.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355520709|gb|AET01163.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 501 Score = 65.5 bits (158), Expect(2) = 5e-10 Identities = 29/61 (47%), Positives = 47/61 (77%) Frame = +3 Query: 222 IFHSPSLSDAKKTFDSILSTSHLPLEVRHHNTLLRSFAQISATVHDSFSFLQHMLKARPA 401 +F SP+L +AK F+S +++S+ P++ R HN+LL+S+A IS T++DS +FL+HM K P+ Sbjct: 60 VFKSPNLQEAKSIFNSFVNSSNAPIDSRFHNSLLQSYASIS-TINDSIAFLRHMTKTHPS 118 Query: 402 F 404 F Sbjct: 119 F 119 Score = 23.1 bits (48), Expect(2) = 5e-10 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +2 Query: 158 QQQEAASQHQNPNPIS 205 +QQ++ SQ Q+P P+S Sbjct: 44 KQQQSQSQSQSPKPVS 59 >ref|XP_003595941.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355484989|gb|AES66192.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 472 Score = 65.5 bits (158), Expect(2) = 5e-10 Identities = 29/61 (47%), Positives = 47/61 (77%) Frame = +3 Query: 222 IFHSPSLSDAKKTFDSILSTSHLPLEVRHHNTLLRSFAQISATVHDSFSFLQHMLKARPA 401 +F SP+L +AK F+S +++S+ P++ R HN+LL+S+A IS T++DS +FL+HM K P+ Sbjct: 76 VFKSPNLQEAKSIFNSFVNSSNAPIDSRFHNSLLQSYASIS-TINDSIAFLRHMTKTHPS 134 Query: 402 F 404 F Sbjct: 135 F 135 Score = 23.1 bits (48), Expect(2) = 5e-10 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +2 Query: 158 QQQEAASQHQNPNPIS 205 +QQ++ SQ Q+P P+S Sbjct: 60 KQQQSQSQSQSPKPVS 75 >gb|AAM62704.1| unknown [Arabidopsis thaliana] Length = 463 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/60 (50%), Positives = 46/60 (76%) Frame = +3 Query: 225 FHSPSLSDAKKTFDSILSTSHLPLEVRHHNTLLRSFAQISATVHDSFSFLQHMLKARPAF 404 F SP+LSDAK F+SI +TS +PL+++ HN++L+S+A I A V D+ F QH++K++P F Sbjct: 60 FKSPNLSDAKSLFNSIAATSRIPLDLKFHNSVLQSYASI-AVVDDTVKFFQHIMKSQPNF 118