BLASTX nr result
ID: Aconitum21_contig00017508
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00017508 (1048 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002489305.1| hypothetical protein SORBIDRAFT_0010s007680 ... 57 1e-05 >ref|XP_002489305.1| hypothetical protein SORBIDRAFT_0010s007680 [Sorghum bicolor] gi|241946953|gb|EES20098.1| hypothetical protein SORBIDRAFT_0010s007680 [Sorghum bicolor] Length = 531 Score = 56.6 bits (135), Expect = 1e-05 Identities = 30/71 (42%), Positives = 41/71 (57%), Gaps = 3/71 (4%) Frame = -1 Query: 715 RVRIDISKPLLRGFIFRDFRGSKS-WSTCKYDQLPHFCFRCDIIGHVEGLCSIPGTAQQQ 539 RV I+I KPL RG + R + + W +Y++LP++CF C I+GH E C PG Q Sbjct: 190 RVAIEIDKPLRRGVLLRMSKAEEPRWFHAQYEKLPYYCFGCGIMGHSEVECLHPGARDDQ 249 Query: 538 --RPYKLWLRA 512 PY + LRA Sbjct: 250 GKLPYDVVLRA 260