BLASTX nr result
ID: Aconitum21_contig00017437
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00017437 (429 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279304.2| PREDICTED: regulator of nonsense transcripts... 58 9e-07 >ref|XP_002279304.2| PREDICTED: regulator of nonsense transcripts 1 homolog [Vitis vinifera] gi|297742168|emb|CBI33955.3| unnamed protein product [Vitis vinifera] Length = 1267 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/38 (73%), Positives = 30/38 (78%), Gaps = 1/38 (2%) Frame = -1 Query: 429 NDTSQDNTSHAPFGVG-PNPLQSQGSMNPLYSQPFAQY 319 ND SQD+ S + FGV PNPLQSQG MNPLYSQPFA Y Sbjct: 1193 NDPSQDDASQSHFGVANPNPLQSQGLMNPLYSQPFAHY 1230