BLASTX nr result
ID: Aconitum21_contig00017404
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00017404 (460 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003610835.1| Cytochrome P450 [Medicago truncatula] gi|355... 79 4e-13 ref|XP_003610827.1| Cytochrome P450 [Medicago truncatula] gi|355... 79 4e-13 gb|ABD97100.1| cytochrome P450 monooxygenase CYP76X3 [Medicago t... 79 4e-13 sp|P37121.1|C76A1_SOLME RecName: Full=Cytochrome P450 76A1; AltN... 79 5e-13 ref|XP_003610828.1| Cytochrome P450 monooxygenase [Medicago trun... 77 1e-12 >ref|XP_003610835.1| Cytochrome P450 [Medicago truncatula] gi|355512170|gb|AES93793.1| Cytochrome P450 [Medicago truncatula] Length = 467 Score = 79.0 bits (193), Expect = 4e-13 Identities = 36/45 (80%), Positives = 37/45 (82%) Frame = +1 Query: 325 RLHPVAPLLLPRKAMEDTEFMGYSIPKGAQILVNVWAIGRDPVSW 459 RLHP+APLLLPRKA ED E GY IPKGAQI VNVWAIGRDP W Sbjct: 328 RLHPIAPLLLPRKAKEDVEVNGYLIPKGAQIFVNVWAIGRDPKVW 372 >ref|XP_003610827.1| Cytochrome P450 [Medicago truncatula] gi|355512162|gb|AES93785.1| Cytochrome P450 [Medicago truncatula] Length = 500 Score = 79.0 bits (193), Expect = 4e-13 Identities = 36/45 (80%), Positives = 37/45 (82%) Frame = +1 Query: 325 RLHPVAPLLLPRKAMEDTEFMGYSIPKGAQILVNVWAIGRDPVSW 459 RLHP+APLLLPRKA ED E GY IPKGAQI VNVWAIGRDP W Sbjct: 361 RLHPIAPLLLPRKAKEDVEVNGYLIPKGAQIFVNVWAIGRDPKVW 405 >gb|ABD97100.1| cytochrome P450 monooxygenase CYP76X3 [Medicago truncatula] Length = 364 Score = 79.0 bits (193), Expect = 4e-13 Identities = 36/45 (80%), Positives = 37/45 (82%) Frame = +1 Query: 325 RLHPVAPLLLPRKAMEDTEFMGYSIPKGAQILVNVWAIGRDPVSW 459 RLHP+APLLLPRKA ED E GY IPKGAQI VNVWAIGRDP W Sbjct: 225 RLHPIAPLLLPRKAKEDVEVNGYLIPKGAQIFVNVWAIGRDPKVW 269 >sp|P37121.1|C76A1_SOLME RecName: Full=Cytochrome P450 76A1; AltName: Full=CYPLXXVIA1; AltName: Full=Cytochrome P-450EG8 gi|1345576|emb|CAA50649.1| unnamed protein product [Solanum melongena] Length = 467 Score = 78.6 bits (192), Expect = 5e-13 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = +1 Query: 325 RLHPVAPLLLPRKAMEDTEFMGYSIPKGAQILVNVWAIGRDPVSW 459 RLHP PLL+PRKA++DT+FMGY IPKG Q+LVN WAIGRDP W Sbjct: 331 RLHPPLPLLIPRKAIQDTKFMGYDIPKGTQVLVNAWAIGRDPEYW 375 >ref|XP_003610828.1| Cytochrome P450 monooxygenase [Medicago truncatula] gi|355512163|gb|AES93786.1| Cytochrome P450 monooxygenase [Medicago truncatula] Length = 479 Score = 77.4 bits (189), Expect = 1e-12 Identities = 35/45 (77%), Positives = 37/45 (82%) Frame = +1 Query: 325 RLHPVAPLLLPRKAMEDTEFMGYSIPKGAQILVNVWAIGRDPVSW 459 RLHP+APLLLPRKA ED E GY+IPK AQI VNVWAIGRDP W Sbjct: 340 RLHPIAPLLLPRKAKEDVEVNGYTIPKDAQIFVNVWAIGRDPEVW 384