BLASTX nr result
ID: Aconitum21_contig00017400
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00017400 (399 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532013.1| conserved hypothetical protein [Ricinus comm... 49 2e-06 >ref|XP_002532013.1| conserved hypothetical protein [Ricinus communis] gi|223528325|gb|EEF30368.1| conserved hypothetical protein [Ricinus communis] Length = 781 Score = 48.5 bits (114), Expect(2) = 2e-06 Identities = 22/44 (50%), Positives = 32/44 (72%) Frame = +3 Query: 186 VANDIPVPGVQMVLNYDDGDRVQFSRLDSYITTHSNEVARALEK 317 ++ IPVPGV+ VL Y+D + FSR D+YI+ +++EV RAL K Sbjct: 525 ISKAIPVPGVREVLGYEDSSSLPFSRQDAYISFNNDEVVRALTK 568 Score = 27.7 bits (60), Expect(2) = 2e-06 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +1 Query: 313 KKTSIYKISQDDEEWLEKQNS 375 K+T+ Y + +DEEWL+K NS Sbjct: 568 KRTANYDMDCEDEEWLKKFNS 588