BLASTX nr result
ID: Aconitum21_contig00017158
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00017158 (453 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519724.1| chlorophyll A/B binding protein, putative [R... 75 7e-12 ref|XP_002524616.1| chlorophyll A/B binding protein, putative [R... 75 7e-12 ref|XP_004164941.1| PREDICTED: chlorophyll a-b binding protein 4... 74 2e-11 ref|XP_004147416.1| PREDICTED: chlorophyll a-b binding protein 4... 74 2e-11 gb|AAA80593.1| chlorophyll a/b binding protein [Solanum tuberosum] 73 2e-11 >ref|XP_002519724.1| chlorophyll A/B binding protein, putative [Ricinus communis] gi|223541141|gb|EEF42697.1| chlorophyll A/B binding protein, putative [Ricinus communis] Length = 265 Score = 74.7 bits (182), Expect = 7e-12 Identities = 36/58 (62%), Positives = 41/58 (70%) Frame = +2 Query: 278 GKSLNLSPSTPKLLFGEGRVTMRXXXXXXXXXXXXWYGPDRVKYLGPFSGESPSYLTG 451 GK++ LSPS P+L+ G GRV+MR WYGPDRVKYLGPFSGE PSYLTG Sbjct: 15 GKAVKLSPSAPELM-GNGRVSMRKTAAKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTG 71 >ref|XP_002524616.1| chlorophyll A/B binding protein, putative [Ricinus communis] gi|223536169|gb|EEF37824.1| chlorophyll A/B binding protein, putative [Ricinus communis] Length = 265 Score = 74.7 bits (182), Expect = 7e-12 Identities = 36/58 (62%), Positives = 41/58 (70%) Frame = +2 Query: 278 GKSLNLSPSTPKLLFGEGRVTMRXXXXXXXXXXXXWYGPDRVKYLGPFSGESPSYLTG 451 GK++ LSPS P+L+ G GRV+MR WYGPDRVKYLGPFSGE PSYLTG Sbjct: 15 GKAVKLSPSAPELM-GNGRVSMRKTAAKNVSSGSPWYGPDRVKYLGPFSGEPPSYLTG 71 >ref|XP_004164941.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like, partial [Cucumis sativus] Length = 149 Score = 73.6 bits (179), Expect = 2e-11 Identities = 36/58 (62%), Positives = 40/58 (68%) Frame = +2 Query: 278 GKSLNLSPSTPKLLFGEGRVTMRXXXXXXXXXXXXWYGPDRVKYLGPFSGESPSYLTG 451 GK + L+PS+P+L FG RVTMR WYGPDRVKYLGPFSGE PSYLTG Sbjct: 15 GKVVKLTPSSPEL-FGNSRVTMRKSATKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTG 71 >ref|XP_004147416.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like [Cucumis sativus] Length = 265 Score = 73.6 bits (179), Expect = 2e-11 Identities = 36/58 (62%), Positives = 40/58 (68%) Frame = +2 Query: 278 GKSLNLSPSTPKLLFGEGRVTMRXXXXXXXXXXXXWYGPDRVKYLGPFSGESPSYLTG 451 GK + L+PS+P+L FG RVTMR WYGPDRVKYLGPFSGE PSYLTG Sbjct: 15 GKVVKLTPSSPEL-FGNSRVTMRKSATKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTG 71 >gb|AAA80593.1| chlorophyll a/b binding protein [Solanum tuberosum] Length = 265 Score = 73.2 bits (178), Expect = 2e-11 Identities = 35/58 (60%), Positives = 41/58 (70%) Frame = +2 Query: 278 GKSLNLSPSTPKLLFGEGRVTMRXXXXXXXXXXXXWYGPDRVKYLGPFSGESPSYLTG 451 G+++ LSPST ++ G GR+TMR WYGPDRVKYLGPFSGESPSYLTG Sbjct: 15 GQAVKLSPSTSEIT-GNGRITMRKAVAKSAPSSSPWYGPDRVKYLGPFSGESPSYLTG 71