BLASTX nr result
ID: Aconitum21_contig00016999
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00016999 (786 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_566042.2| little zipper 1 protein [Arabidopsis thaliana] ... 58 3e-06 >ref|NP_566042.2| little zipper 1 protein [Arabidopsis thaliana] gi|330255461|gb|AEC10555.1| little zipper 1 protein [Arabidopsis thaliana] Length = 136 Score = 57.8 bits (138), Expect = 3e-06 Identities = 43/106 (40%), Positives = 61/106 (57%), Gaps = 3/106 (2%) Frame = -3 Query: 583 TYLSSLNPLFSLSVYHIMCLGASEFNTNSPFNTP-FCRKRSRIRVHGLTRWRRRLSGTE- 410 TYLSS F LS MCL +SE +++P + + +S +R+ L+R RRR+ E Sbjct: 30 TYLSSS---FLLSSSSKMCLSSSETFSDTPTRLVLYLKTQSHVRIPRLSR-RRRMWREEK 85 Query: 409 -MXXXXXXXXXXXKSIVEENAKLRRKALLLHQENQTLMLELQKKKI 275 M ++I+ EN KL++KALLLHQEN+TL LQ KK+ Sbjct: 86 KMEMINLKLYVENQNIIRENEKLKKKALLLHQENKTLFSLLQTKKL 131