BLASTX nr result
ID: Aconitum21_contig00016604
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00016604 (391 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_974157.1| 12-oxophytodienoate reductase 1 [Arabidopsis th... 102 2e-20 gb|AAM65337.1| 12-oxophytodienoate reductase (OPR1) [Arabidopsis... 102 2e-20 ref|NP_177794.1| 12-oxophytodienoate reductase 1 [Arabidopsis th... 102 2e-20 ref|XP_003517567.1| PREDICTED: 12-oxophytodienoate reductase 2-l... 102 2e-20 ref|XP_002887653.1| 12-oxophytodienoate reductase 1 [Arabidopsis... 102 2e-20 >ref|NP_974157.1| 12-oxophytodienoate reductase 1 [Arabidopsis thaliana] gi|332197753|gb|AEE35874.1| 12-oxophytodienoate reductase 1 [Arabidopsis thaliana] Length = 397 Score = 102 bits (255), Expect = 2e-20 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = +2 Query: 5 DLVAYGRWFLANPDLPKRFELNAPLNKYDRDTFYTSDPVVGYVDYPFLESS 157 DLVAYGRWFLANPDLPKRF+++APLNKYDR TFYTSDPVVGY DYPFLES+ Sbjct: 346 DLVAYGRWFLANPDLPKRFQVDAPLNKYDRPTFYTSDPVVGYTDYPFLEST 396 >gb|AAM65337.1| 12-oxophytodienoate reductase (OPR1) [Arabidopsis thaliana] Length = 372 Score = 102 bits (255), Expect = 2e-20 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = +2 Query: 5 DLVAYGRWFLANPDLPKRFELNAPLNKYDRDTFYTSDPVVGYVDYPFLESS 157 DLVAYGRWFLANPDLPKRF+++APLNKYDR TFYTSDPVVGY DYPFLES+ Sbjct: 321 DLVAYGRWFLANPDLPKRFQVDAPLNKYDRPTFYTSDPVVGYTDYPFLEST 371 >ref|NP_177794.1| 12-oxophytodienoate reductase 1 [Arabidopsis thaliana] gi|62900695|sp|Q8LAH7.2|OPR1_ARATH RecName: Full=12-oxophytodienoate reductase 1; AltName: Full=12-oxophytodienoate-10,11-reductase 1; Short=AtOPR1; Short=OPDA-reductase 1; AltName: Full=FS-AT-I gi|47169454|pdb|1VJI|A Chain A, Gene Product Of At1g76680 From Arabidopsis Thaliana gi|150261456|pdb|2Q3R|A Chain A, Ensemble Refinement Of The Protein Crystal Structure Of At1g76680 From Arabidopsis Thaliana gi|6143902|gb|AAF04448.1|AC010718_17 12-oxophytodienoate reductase (OPR1); 13754-15043 [Arabidopsis thaliana] gi|3882355|gb|AAC78440.1| 12-oxophytodienoate reductase OPR1 [Arabidopsis thaliana] gi|18650650|gb|AAL75894.1| At1g76680/F28O16_5 [Arabidopsis thaliana] gi|56382003|gb|AAV85720.1| At1g76680 [Arabidopsis thaliana] gi|332197754|gb|AEE35875.1| 12-oxophytodienoate reductase 1 [Arabidopsis thaliana] Length = 372 Score = 102 bits (255), Expect = 2e-20 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = +2 Query: 5 DLVAYGRWFLANPDLPKRFELNAPLNKYDRDTFYTSDPVVGYVDYPFLESS 157 DLVAYGRWFLANPDLPKRF+++APLNKYDR TFYTSDPVVGY DYPFLES+ Sbjct: 321 DLVAYGRWFLANPDLPKRFQVDAPLNKYDRPTFYTSDPVVGYTDYPFLEST 371 >ref|XP_003517567.1| PREDICTED: 12-oxophytodienoate reductase 2-like [Glycine max] Length = 371 Score = 102 bits (255), Expect = 2e-20 Identities = 48/59 (81%), Positives = 52/59 (88%), Gaps = 2/59 (3%) Frame = +2 Query: 2 ADLVAYGRWFLANPDLPKRFELNAPLNKYDRDTFYTSDPVVGYVDYPFL--ESSNVVSN 172 ADLVAYGRWFLANPDLPKRF LNAPLNKY R+TFYTSDPV+GY DYPFL E SN V++ Sbjct: 313 ADLVAYGRWFLANPDLPKRFALNAPLNKYHRETFYTSDPVLGYTDYPFLDDEESNAVAS 371 >ref|XP_002887653.1| 12-oxophytodienoate reductase 1 [Arabidopsis lyrata subsp. lyrata] gi|297333494|gb|EFH63912.1| 12-oxophytodienoate reductase 1 [Arabidopsis lyrata subsp. lyrata] Length = 372 Score = 102 bits (255), Expect = 2e-20 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = +2 Query: 5 DLVAYGRWFLANPDLPKRFELNAPLNKYDRDTFYTSDPVVGYVDYPFLESS 157 DLVAYGRWFLANPDLPKRF+++APLNKYDR TFYTSDPVVGY DYPFLES+ Sbjct: 321 DLVAYGRWFLANPDLPKRFQVDAPLNKYDRPTFYTSDPVVGYTDYPFLEST 371