BLASTX nr result
ID: Aconitum21_contig00016502
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00016502 (498 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003550617.1| PREDICTED: DUF246 domain-containing protein ... 100 2e-19 ref|XP_003542359.1| PREDICTED: DUF246 domain-containing protein ... 97 2e-18 ref|XP_002279041.1| PREDICTED: DUF246 domain-containing protein ... 97 2e-18 emb|CAN67382.1| hypothetical protein VITISV_017920 [Vitis vinifera] 97 2e-18 ref|XP_003546504.1| PREDICTED: DUF246 domain-containing protein ... 96 2e-18 >ref|XP_003550617.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Glycine max] Length = 628 Score = 99.8 bits (247), Expect = 2e-19 Identities = 44/52 (84%), Positives = 46/52 (88%) Frame = +2 Query: 2 EGKITWKNFSSKVKRLHEDRNGGPTPREPGEFPKLEESFYANPYPGCICETR 157 EGKI+WK FSSKVK+LH DR G P PREPGEFPKLEESFYANP PGCICETR Sbjct: 577 EGKISWKKFSSKVKKLHTDRIGAPYPREPGEFPKLEESFYANPLPGCICETR 628 >ref|XP_003542359.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Glycine max] Length = 626 Score = 96.7 bits (239), Expect = 2e-18 Identities = 43/52 (82%), Positives = 45/52 (86%) Frame = +2 Query: 2 EGKITWKNFSSKVKRLHEDRNGGPTPREPGEFPKLEESFYANPYPGCICETR 157 EGKI+WK FSSKVK+LH DR G P PRE GEFPKLEESFYANP PGCICETR Sbjct: 575 EGKISWKKFSSKVKKLHTDRIGAPYPRETGEFPKLEESFYANPLPGCICETR 626 >ref|XP_002279041.1| PREDICTED: DUF246 domain-containing protein At1g04910 [Vitis vinifera] gi|297738571|emb|CBI27816.3| unnamed protein product [Vitis vinifera] Length = 634 Score = 96.7 bits (239), Expect = 2e-18 Identities = 43/51 (84%), Positives = 45/51 (88%) Frame = +2 Query: 2 EGKITWKNFSSKVKRLHEDRNGGPTPREPGEFPKLEESFYANPYPGCICET 154 EGKITWK FSSKVK+LH+DR G P REPGEFPKLEESFYANP PGCICET Sbjct: 580 EGKITWKKFSSKVKKLHKDRAGAPYLREPGEFPKLEESFYANPLPGCICET 630 >emb|CAN67382.1| hypothetical protein VITISV_017920 [Vitis vinifera] Length = 514 Score = 96.7 bits (239), Expect = 2e-18 Identities = 43/51 (84%), Positives = 45/51 (88%) Frame = +2 Query: 2 EGKITWKNFSSKVKRLHEDRNGGPTPREPGEFPKLEESFYANPYPGCICET 154 EGKITWK FSSKVK+LH+DR G P REPGEFPKLEESFYANP PGCICET Sbjct: 460 EGKITWKKFSSKVKKLHKDRAGAPYLREPGEFPKLEESFYANPLPGCICET 510 >ref|XP_003546504.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Glycine max] Length = 597 Score = 96.3 bits (238), Expect = 2e-18 Identities = 43/52 (82%), Positives = 45/52 (86%) Frame = +2 Query: 2 EGKITWKNFSSKVKRLHEDRNGGPTPREPGEFPKLEESFYANPYPGCICETR 157 EGKI+WK FSSKVKRLHEDR G P PRE GEFPKLEESFYANP PGCICE + Sbjct: 541 EGKISWKKFSSKVKRLHEDRIGAPYPRERGEFPKLEESFYANPLPGCICERK 592