BLASTX nr result
ID: Aconitum21_contig00015762
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00015762 (418 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003580299.1| PREDICTED: probable phospholipid hydroperoxi... 96 3e-18 gb|AAQ03092.1| glutathione peroxidase [Malus x domestica] 96 4e-18 gb|AAA76742.1| putative ORF1, partial [Avena fatua] 94 9e-18 gb|ACI04528.1| glutathione peroxidase [Litchi chinensis] gi|2174... 94 9e-18 ref|XP_002446921.1| hypothetical protein SORBIDRAFT_06g024920 [S... 94 1e-17 >ref|XP_003580299.1| PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase 6, mitochondrial-like [Brachypodium distachyon] Length = 168 Score = 95.9 bits (237), Expect = 3e-18 Identities = 44/52 (84%), Positives = 49/52 (94%) Frame = -2 Query: 417 LKSSKGGILGDSIEWNFSKFLVDKEGRVADHYAPTTSPLNIEKDIKKLLGVA 262 LKSSKGGI GDS++WNFSKFLVDKEGRV D YAPTTSPL+IEKDIKKLLG++ Sbjct: 117 LKSSKGGIFGDSVKWNFSKFLVDKEGRVVDRYAPTTSPLSIEKDIKKLLGIS 168 >gb|AAQ03092.1| glutathione peroxidase [Malus x domestica] Length = 168 Score = 95.5 bits (236), Expect = 4e-18 Identities = 44/52 (84%), Positives = 49/52 (94%) Frame = -2 Query: 417 LKSSKGGILGDSIEWNFSKFLVDKEGRVADHYAPTTSPLNIEKDIKKLLGVA 262 LKSSKGG+ GDSI+WNFSKFLVDKEG+V D YAPTTSPL+IEKD+KKLLGVA Sbjct: 117 LKSSKGGLFGDSIKWNFSKFLVDKEGKVVDRYAPTTSPLSIEKDVKKLLGVA 168 >gb|AAA76742.1| putative ORF1, partial [Avena fatua] Length = 116 Score = 94.4 bits (233), Expect = 9e-18 Identities = 44/52 (84%), Positives = 48/52 (92%) Frame = -2 Query: 417 LKSSKGGILGDSIEWNFSKFLVDKEGRVADHYAPTTSPLNIEKDIKKLLGVA 262 LKSSKGG+ GDSI+WNFSKFLVDKEGRV D YAPTTSPL+IEKDIKKLLG + Sbjct: 65 LKSSKGGLFGDSIKWNFSKFLVDKEGRVVDRYAPTTSPLSIEKDIKKLLGTS 116 >gb|ACI04528.1| glutathione peroxidase [Litchi chinensis] gi|217416912|gb|ACK44111.1| glutathione peroxidase [Litchi chinensis] Length = 168 Score = 94.4 bits (233), Expect = 9e-18 Identities = 43/52 (82%), Positives = 48/52 (92%) Frame = -2 Query: 417 LKSSKGGILGDSIEWNFSKFLVDKEGRVADHYAPTTSPLNIEKDIKKLLGVA 262 LKSSKGG+ GDSI+WNFSKFLVDKEG V D YAPTTSPL+IEKD+KKLLG+A Sbjct: 117 LKSSKGGLFGDSIKWNFSKFLVDKEGNVVDRYAPTTSPLSIEKDVKKLLGIA 168 >ref|XP_002446921.1| hypothetical protein SORBIDRAFT_06g024920 [Sorghum bicolor] gi|48374968|gb|AAT42166.1| putative glutathione peroxidase [Sorghum bicolor] gi|241938104|gb|EES11249.1| hypothetical protein SORBIDRAFT_06g024920 [Sorghum bicolor] Length = 168 Score = 94.0 bits (232), Expect = 1e-17 Identities = 44/50 (88%), Positives = 47/50 (94%) Frame = -2 Query: 417 LKSSKGGILGDSIEWNFSKFLVDKEGRVADHYAPTTSPLNIEKDIKKLLG 268 LKSSKGG+ GDSI+WNFSKFLVDKEGRV D YAPTTSPL+IEKDIKKLLG Sbjct: 117 LKSSKGGLFGDSIKWNFSKFLVDKEGRVVDRYAPTTSPLSIEKDIKKLLG 166