BLASTX nr result
ID: Aconitum21_contig00015485
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00015485 (438 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002742457.1| PREDICTED: a disintegrin-like and metallopro... 58 9e-07 ref|XP_003868554.1| Iff5 GPI-anchored protein [Candida orthopsil... 54 1e-05 >ref|XP_002742457.1| PREDICTED: a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 15 preproprotein-like [Saccoglossus kowalevskii] Length = 603 Score = 57.8 bits (138), Expect = 9e-07 Identities = 35/107 (32%), Positives = 60/107 (56%), Gaps = 1/107 (0%) Frame = -2 Query: 434 SFTIPSDLLAPSVFSFTIPSGMQAPSVFSFTIPSGPLAPSVLSFTIHSGLLAPSVISVVI 255 S + S L P+V S + S P+V S + S L P+V S + S L P+ +S + Sbjct: 427 SEAVKSLWLTPNVVSEAVKSQWLTPNVASEAVKSLWLTPNVASEAVKSQWLTPNDVSEAV 486 Query: 254 PSGWLAPSVTSVAIPSGWLAPSGTAV-TKSATSSIINQLFQSEDISQ 117 S WL P+V S A+ S WL P+ +AV ++ T +++++ +S+ ++Q Sbjct: 487 TSQWLTPNVASEAVKSQWLTPNVSAVKSQWLTPNVVSETVKSQWLTQ 533 >ref|XP_003868554.1| Iff5 GPI-anchored protein [Candida orthopsilosis Co 90-125] gi|380352894|emb|CCG25650.1| Iff5 GPI-anchored protein [Candida orthopsilosis] Length = 857 Score = 54.3 bits (129), Expect = 1e-05 Identities = 33/85 (38%), Positives = 43/85 (50%), Gaps = 1/85 (1%) Frame = +1 Query: 187 PEGAS-QPEGMATEVTEGASQPEGMTTEITEGASRPECIVKESTEGASGPEGIVKENTEG 363 P GAS +P G ++E T +S+P G ++E T +S P E T +S P G E T Sbjct: 467 PTGASSEPTGASSEPTGASSEPTGASSEPTGASSEPSGASSEPTGASSEPSGASSEPTGA 526 Query: 364 ACIPEGIVKENTEGASRSEGIVNEN 438 + P G E T AS S G V EN Sbjct: 527 SSEPSGASSEPTGNASSSTGAVTEN 551