BLASTX nr result
ID: Aconitum21_contig00015461
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00015461 (402 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003539517.1| PREDICTED: G-type lectin S-receptor-like ser... 55 6e-06 >ref|XP_003539517.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At2g19130-like [Glycine max] Length = 787 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/47 (51%), Positives = 34/47 (72%) Frame = +3 Query: 6 YVENENESYVTYNVSDSSILYRFVMELSGQFTLFSFDDELQDWTSLW 146 +V NENESY TY++ +SSI+ RFVM++SGQ FS+ ++ Q W W Sbjct: 244 FVMNENESYFTYSMYNSSIMSRFVMDVSGQIKQFSWLEKTQQWNLFW 290