BLASTX nr result
ID: Aconitum21_contig00015456
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00015456 (453 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510562.1| conserved hypothetical protein [Ricinus comm... 55 5e-06 >ref|XP_002510562.1| conserved hypothetical protein [Ricinus communis] gi|223551263|gb|EEF52749.1| conserved hypothetical protein [Ricinus communis] Length = 263 Score = 55.5 bits (132), Expect = 5e-06 Identities = 33/92 (35%), Positives = 44/92 (47%) Frame = -1 Query: 315 FSCLSWIQHLCNQVSELFVPNMPVVQDLDEVTDRELPYELIVDILSRLPADCVVPCVHAC 136 F C WI H+ ++ +F P L R LP ++I +ILSRLPAD V+ C Sbjct: 3 FECFIWIVHIWKELLSIFPP-------LKGGDVRPLPNDIIFEILSRLPADEVLKCCSVS 55 Query: 135 KPLLDLTRTQSFVSLHLKRASPVIAFQYFVPD 40 K L T F L RA P++ QY P+ Sbjct: 56 KEWKALVLTPFFSQAQLTRACPIVFIQYRRPE 87