BLASTX nr result
ID: Aconitum21_contig00015288
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00015288 (406 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517886.1| ADP,ATP carrier protein, putative [Ricinus c... 114 6e-24 ref|XP_002531911.1| ADP,ATP carrier protein, putative [Ricinus c... 114 8e-24 ref|XP_002299948.1| predicted protein [Populus trichocarpa] gi|2... 113 2e-23 gb|ADN33720.1| adenine nucleotide translocator [Cucumis melo sub... 112 4e-23 gb|ADN33719.1| adenine nucleotide translocator [Cucumis melo sub... 112 4e-23 >ref|XP_002517886.1| ADP,ATP carrier protein, putative [Ricinus communis] gi|223542868|gb|EEF44404.1| ADP,ATP carrier protein, putative [Ricinus communis] Length = 379 Score = 114 bits (286), Expect = 6e-24 Identities = 58/72 (80%), Positives = 60/72 (83%) Frame = +1 Query: 1 VRRRMMMTSGEAIKYKGSLDAFSQILKNEGFKSLFKGAGANILRXXXXXXXXXXYDKLQL 180 VRRRMMMTSGEA+KYK SLDAFSQI+KNEG KSLFKGAGANILR YDKLQL Sbjct: 307 VRRRMMMTSGEAVKYKSSLDAFSQIMKNEGAKSLFKGAGANILRAVAGAGVLAGYDKLQL 366 Query: 181 IVFGKKYGSGGG 216 IVFGKKYGSGGG Sbjct: 367 IVFGKKYGSGGG 378 >ref|XP_002531911.1| ADP,ATP carrier protein, putative [Ricinus communis] gi|223528451|gb|EEF30484.1| ADP,ATP carrier protein, putative [Ricinus communis] Length = 385 Score = 114 bits (285), Expect = 8e-24 Identities = 58/71 (81%), Positives = 60/71 (84%) Frame = +1 Query: 1 VRRRMMMTSGEAIKYKGSLDAFSQILKNEGFKSLFKGAGANILRXXXXXXXXXXYDKLQL 180 VRRRMMMTSGEA+KY+GSLDAFSQILKNEG KSLFKGAGANILR YDKLQL Sbjct: 314 VRRRMMMTSGEAVKYRGSLDAFSQILKNEGAKSLFKGAGANILRAVAGAGVLAGYDKLQL 373 Query: 181 IVFGKKYGSGG 213 IVFGKKYGSGG Sbjct: 374 IVFGKKYGSGG 384 >ref|XP_002299948.1| predicted protein [Populus trichocarpa] gi|222847206|gb|EEE84753.1| predicted protein [Populus trichocarpa] Length = 389 Score = 113 bits (282), Expect = 2e-23 Identities = 58/71 (81%), Positives = 59/71 (83%) Frame = +1 Query: 1 VRRRMMMTSGEAIKYKGSLDAFSQILKNEGFKSLFKGAGANILRXXXXXXXXXXYDKLQL 180 VRRRMMMTSGEA+KYK SLDAFSQILKNEG KSLFKGAGANILR YDKLQL Sbjct: 318 VRRRMMMTSGEAVKYKSSLDAFSQILKNEGAKSLFKGAGANILRAVAGAGVLAGYDKLQL 377 Query: 181 IVFGKKYGSGG 213 IVFGKKYGSGG Sbjct: 378 IVFGKKYGSGG 388 >gb|ADN33720.1| adenine nucleotide translocator [Cucumis melo subsp. melo] Length = 390 Score = 112 bits (279), Expect = 4e-23 Identities = 57/71 (80%), Positives = 59/71 (83%) Frame = +1 Query: 1 VRRRMMMTSGEAIKYKGSLDAFSQILKNEGFKSLFKGAGANILRXXXXXXXXXXYDKLQL 180 VRRRMMMTSGEA+KYK SLDAFSQILKNEG KSLFKGAGANILR YDKLQ+ Sbjct: 319 VRRRMMMTSGEAVKYKSSLDAFSQILKNEGAKSLFKGAGANILRAVAGAGVLAGYDKLQV 378 Query: 181 IVFGKKYGSGG 213 IVFGKKYGSGG Sbjct: 379 IVFGKKYGSGG 389 >gb|ADN33719.1| adenine nucleotide translocator [Cucumis melo subsp. melo] Length = 390 Score = 112 bits (279), Expect = 4e-23 Identities = 57/71 (80%), Positives = 59/71 (83%) Frame = +1 Query: 1 VRRRMMMTSGEAIKYKGSLDAFSQILKNEGFKSLFKGAGANILRXXXXXXXXXXYDKLQL 180 VRRRMMMTSGEA+KYK SLDAFSQILKNEG KSLFKGAGANILR YDKLQ+ Sbjct: 319 VRRRMMMTSGEAVKYKSSLDAFSQILKNEGAKSLFKGAGANILRAVAGAGVLAGYDKLQV 378 Query: 181 IVFGKKYGSGG 213 IVFGKKYGSGG Sbjct: 379 IVFGKKYGSGG 389