BLASTX nr result
ID: Aconitum21_contig00014237
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00014237 (520 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004143478.1| PREDICTED: inositol-3-phosphate synthase-lik... 104 7e-21 gb|AAK21969.1| myo-inositol 1-phosphate synthase [Avicennia marina] 104 7e-21 gb|ABC55421.1| myo-inositol-1-phosphate synthase [Glycine max] 104 7e-21 sp|Q9FYV1.1|INO1_SESIN RecName: Full=Inositol-3-phosphate syntha... 104 7e-21 sp|P42802.1|INO1_CITPA RecName: Full=Inositol-3-phosphate syntha... 104 7e-21 >ref|XP_004143478.1| PREDICTED: inositol-3-phosphate synthase-like [Cucumis sativus] gi|449504829|ref|XP_004162306.1| PREDICTED: inositol-3-phosphate synthase-like [Cucumis sativus] Length = 510 Score = 104 bits (260), Expect = 7e-21 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +1 Query: 1 VATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 156 VATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK Sbjct: 459 VATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510 >gb|AAK21969.1| myo-inositol 1-phosphate synthase [Avicennia marina] Length = 509 Score = 104 bits (260), Expect = 7e-21 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +1 Query: 1 VATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 156 VATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK Sbjct: 458 VATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 509 >gb|ABC55421.1| myo-inositol-1-phosphate synthase [Glycine max] Length = 510 Score = 104 bits (260), Expect = 7e-21 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +1 Query: 1 VATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 156 VATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK Sbjct: 459 VATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510 >sp|Q9FYV1.1|INO1_SESIN RecName: Full=Inositol-3-phosphate synthase; Short=MIP synthase; AltName: Full=Myo-inositol 1-phosphate synthase; Short=IPS; Short=MI-1-P synthase gi|9858816|gb|AAG01148.1| myo-inositol 1-phosphate synthase [Sesamum indicum] Length = 510 Score = 104 bits (260), Expect = 7e-21 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +1 Query: 1 VATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 156 VATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK Sbjct: 459 VATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510 >sp|P42802.1|INO1_CITPA RecName: Full=Inositol-3-phosphate synthase; Short=MIP synthase; AltName: Full=Myo-inositol 1-phosphate synthase; Short=IPS; Short=MI-1-P synthase gi|602565|emb|CAA83565.1| INO1 [Citrus x paradisi] Length = 507 Score = 104 bits (260), Expect = 7e-21 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +1 Query: 1 VATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 156 VATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK Sbjct: 456 VATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 507