BLASTX nr result
ID: Aconitum21_contig00014109
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00014109 (805 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271646.2| PREDICTED: cleavage and polyadenylation spec... 75 1e-11 ref|XP_003633408.1| PREDICTED: cleavage and polyadenylation spec... 75 1e-11 emb|CBI29794.3| unnamed protein product [Vitis vinifera] 75 1e-11 emb|CBI29772.3| unnamed protein product [Vitis vinifera] 75 1e-11 ref|XP_003592965.1| Cleavage and polyadenylation specificity fac... 75 1e-11 >ref|XP_002271646.2| PREDICTED: cleavage and polyadenylation specificity factor subunit 3-I-like [Vitis vinifera] Length = 693 Score = 75.5 bits (184), Expect = 1e-11 Identities = 37/48 (77%), Positives = 38/48 (79%) Frame = -1 Query: 292 LFVTHFHLSHDVPLPYFHEKTTLKGCVFMTCATKAIYKLYLSDYVKIS 149 L VTHFHL H LPYF EKTT KG VFMT ATKAIYKL LSDYVK+S Sbjct: 78 LLVTHFHLDHAASLPYFLEKTTFKGRVFMTHATKAIYKLLLSDYVKVS 125 >ref|XP_003633408.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 3-I-like [Vitis vinifera] Length = 694 Score = 75.5 bits (184), Expect = 1e-11 Identities = 37/48 (77%), Positives = 38/48 (79%) Frame = -1 Query: 292 LFVTHFHLSHDVPLPYFHEKTTLKGCVFMTCATKAIYKLYLSDYVKIS 149 L VTHFHL H LPYF EKTT KG VFMT ATKAIYKL LSDYVK+S Sbjct: 79 LLVTHFHLDHAASLPYFLEKTTFKGRVFMTHATKAIYKLLLSDYVKVS 126 >emb|CBI29794.3| unnamed protein product [Vitis vinifera] Length = 581 Score = 75.5 bits (184), Expect = 1e-11 Identities = 37/48 (77%), Positives = 38/48 (79%) Frame = -1 Query: 292 LFVTHFHLSHDVPLPYFHEKTTLKGCVFMTCATKAIYKLYLSDYVKIS 149 L VTHFHL H LPYF EKTT KG VFMT ATKAIYKL LSDYVK+S Sbjct: 78 LLVTHFHLDHAASLPYFLEKTTFKGRVFMTHATKAIYKLLLSDYVKVS 125 >emb|CBI29772.3| unnamed protein product [Vitis vinifera] Length = 680 Score = 75.5 bits (184), Expect = 1e-11 Identities = 37/48 (77%), Positives = 38/48 (79%) Frame = -1 Query: 292 LFVTHFHLSHDVPLPYFHEKTTLKGCVFMTCATKAIYKLYLSDYVKIS 149 L VTHFHL H LPYF EKTT KG VFMT ATKAIYKL LSDYVK+S Sbjct: 79 LLVTHFHLDHAASLPYFLEKTTFKGRVFMTHATKAIYKLLLSDYVKVS 126 >ref|XP_003592965.1| Cleavage and polyadenylation specificity factor subunit 3-I [Medicago truncatula] gi|357445453|ref|XP_003593004.1| Cleavage and polyadenylation specificity factor subunit 3-I [Medicago truncatula] gi|355482013|gb|AES63216.1| Cleavage and polyadenylation specificity factor subunit 3-I [Medicago truncatula] gi|355482052|gb|AES63255.1| Cleavage and polyadenylation specificity factor subunit 3-I [Medicago truncatula] Length = 690 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/48 (75%), Positives = 38/48 (79%) Frame = -1 Query: 292 LFVTHFHLSHDVPLPYFHEKTTLKGCVFMTCATKAIYKLYLSDYVKIS 149 L +THFHL H LPYF EKTT KG VFMT ATKAIYKL LSDYVK+S Sbjct: 77 LLITHFHLDHAASLPYFLEKTTFKGRVFMTYATKAIYKLLLSDYVKVS 124