BLASTX nr result
ID: Aconitum21_contig00012460
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00012460 (998 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275924.1| PREDICTED: chaperone protein dnaJ 11, chloro... 59 2e-06 >ref|XP_002275924.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic [Vitis vinifera] gi|296090000|emb|CBI39819.3| unnamed protein product [Vitis vinifera] Length = 148 Score = 58.9 bits (141), Expect = 2e-06 Identities = 28/47 (59%), Positives = 39/47 (82%) Frame = -3 Query: 963 NLYQVLRLHRSASPAEIKVSYRSLVKEFHPDANRLNSCDDRDFIQIH 823 +LY+VLR+ ++ASP EIK +YRSL K +HPDA+ ++S D R+FIQIH Sbjct: 49 SLYEVLRVKQTASPTEIKTAYRSLAKMYHPDASPVDS-DGRNFIQIH 94