BLASTX nr result
ID: Aconitum21_contig00012149
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00012149 (709 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI39449.3| unnamed protein product [Vitis vinifera] 118 1e-24 ref|XP_002268048.1| PREDICTED: probable importin-7 homolog [Viti... 118 1e-24 dbj|BAJ99987.1| predicted protein [Hordeum vulgare subsp. vulgare] 117 2e-24 ref|XP_003574969.1| PREDICTED: probable importin-7 homolog [Brac... 117 2e-24 ref|XP_002527757.1| Importin-7, putative [Ricinus communis] gi|2... 115 9e-24 >emb|CBI39449.3| unnamed protein product [Vitis vinifera] Length = 1080 Score = 118 bits (296), Expect = 1e-24 Identities = 56/69 (81%), Positives = 62/69 (89%) Frame = +1 Query: 1 DDEEFQSPIDEVDPFIYFVDTMKALQGMDPARFQNVMQTLDFHYQALASGVAQHAEQRRG 180 DDEE QSPIDEVDPFI+FVDT+KA+Q DP R QN+ QTLDFHYQALA+GVAQHAEQRR Sbjct: 1005 DDEELQSPIDEVDPFIFFVDTVKAMQASDPLRLQNLTQTLDFHYQALANGVAQHAEQRRV 1064 Query: 181 EIEKEKLEK 207 EIEKEK+EK Sbjct: 1065 EIEKEKMEK 1073 >ref|XP_002268048.1| PREDICTED: probable importin-7 homolog [Vitis vinifera] Length = 1034 Score = 118 bits (296), Expect = 1e-24 Identities = 56/69 (81%), Positives = 62/69 (89%) Frame = +1 Query: 1 DDEEFQSPIDEVDPFIYFVDTMKALQGMDPARFQNVMQTLDFHYQALASGVAQHAEQRRG 180 DDEE QSPIDEVDPFI+FVDT+KA+Q DP R QN+ QTLDFHYQALA+GVAQHAEQRR Sbjct: 959 DDEELQSPIDEVDPFIFFVDTVKAMQASDPLRLQNLTQTLDFHYQALANGVAQHAEQRRV 1018 Query: 181 EIEKEKLEK 207 EIEKEK+EK Sbjct: 1019 EIEKEKMEK 1027 >dbj|BAJ99987.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 1031 Score = 117 bits (294), Expect = 2e-24 Identities = 55/69 (79%), Positives = 64/69 (92%) Frame = +1 Query: 1 DDEEFQSPIDEVDPFIYFVDTMKALQGMDPARFQNVMQTLDFHYQALASGVAQHAEQRRG 180 DDEE Q+PIDEVDPFI+FV T++A+Q DPARFQN+MQTLDFHYQALA+GVAQHAE+R+ Sbjct: 959 DDEELQTPIDEVDPFIFFVGTIQAVQASDPARFQNLMQTLDFHYQALANGVAQHAEERKV 1018 Query: 181 EIEKEKLEK 207 EIEKEKLEK Sbjct: 1019 EIEKEKLEK 1027 >ref|XP_003574969.1| PREDICTED: probable importin-7 homolog [Brachypodium distachyon] Length = 1030 Score = 117 bits (293), Expect = 2e-24 Identities = 56/69 (81%), Positives = 62/69 (89%) Frame = +1 Query: 1 DDEEFQSPIDEVDPFIYFVDTMKALQGMDPARFQNVMQTLDFHYQALASGVAQHAEQRRG 180 DDEE QSPIDEVDPFI FV+T+K LQ DPARFQN+MQTLDF YQALA+G+AQHAE+RR Sbjct: 958 DDEELQSPIDEVDPFILFVETVKGLQASDPARFQNLMQTLDFRYQALANGIAQHAEERRV 1017 Query: 181 EIEKEKLEK 207 EIEKEKLEK Sbjct: 1018 EIEKEKLEK 1026 >ref|XP_002527757.1| Importin-7, putative [Ricinus communis] gi|223532844|gb|EEF34618.1| Importin-7, putative [Ricinus communis] Length = 1032 Score = 115 bits (288), Expect = 9e-24 Identities = 53/69 (76%), Positives = 61/69 (88%) Frame = +1 Query: 1 DDEEFQSPIDEVDPFIYFVDTMKALQGMDPARFQNVMQTLDFHYQALASGVAQHAEQRRG 180 DDEE QSPIDEVDPFI+FVDT+K +Q DP RFQN+ Q LDFH+QALA+GVAQHAEQRR Sbjct: 957 DDEELQSPIDEVDPFIFFVDTIKVMQASDPLRFQNLTQALDFHHQALANGVAQHAEQRRA 1016 Query: 181 EIEKEKLEK 207 EIEKE++EK Sbjct: 1017 EIEKERMEK 1025