BLASTX nr result
ID: Aconitum21_contig00011516
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00011516 (420 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273377.1| PREDICTED: rhomboid protease gluP [Vitis vin... 54 1e-05 >ref|XP_002273377.1| PREDICTED: rhomboid protease gluP [Vitis vinifera] gi|298204568|emb|CBI23843.3| unnamed protein product [Vitis vinifera] Length = 330 Score = 54.3 bits (129), Expect = 1e-05 Identities = 30/52 (57%), Positives = 39/52 (75%), Gaps = 2/52 (3%) Frame = +2 Query: 197 ALPSPHWFPKSRNGPTPAHLITTAAALRLGNAVNLLTRKHIQL--LLRTSFK 346 A+P P FP S+ GPTPAHLITTAA+LRLG+ ++ R++I L LR+SFK Sbjct: 5 AVPQPSRFPLSKVGPTPAHLITTAASLRLGHFIH---RQYIHLGFFLRSSFK 53