BLASTX nr result
ID: Aconitum21_contig00009750
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00009750 (363 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278289.1| PREDICTED: cytoplasmic tRNA 2-thiolation pro... 77 1e-12 ref|XP_003521174.1| PREDICTED: cytoplasmic tRNA 2-thiolation pro... 64 1e-08 ref|XP_002529606.1| conserved hypothetical protein [Ricinus comm... 63 3e-08 >ref|XP_002278289.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 2 [Vitis vinifera] gi|297739656|emb|CBI29838.3| unnamed protein product [Vitis vinifera] Length = 468 Score = 77.4 bits (189), Expect = 1e-12 Identities = 39/52 (75%), Positives = 42/52 (80%) Frame = +2 Query: 2 FQILPKETESMEHFYSLLPQQMITRAKDVNGGDQTWLREQIQDFLLSDSEDG 157 FQILPKE SMEHFYSLLPQQ + +AKD + Q LREQIQDFLLSDSEDG Sbjct: 416 FQILPKEPVSMEHFYSLLPQQFVVQAKDRSFSMQRQLREQIQDFLLSDSEDG 467 >ref|XP_003521174.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 2-like [Glycine max] Length = 458 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/51 (58%), Positives = 38/51 (74%) Frame = +2 Query: 2 FQILPKETESMEHFYSLLPQQMITRAKDVNGGDQTWLREQIQDFLLSDSED 154 FQILP ++ +ME FY LPQ ++ RAK N G+ + LREQIQD+LLSD ED Sbjct: 406 FQILPSDSMAMEQFYMDLPQSVVGRAKQANNGNLSLLREQIQDYLLSDGED 456 >ref|XP_002529606.1| conserved hypothetical protein [Ricinus communis] gi|223530891|gb|EEF32751.1| conserved hypothetical protein [Ricinus communis] Length = 167 Score = 62.8 bits (151), Expect = 3e-08 Identities = 31/51 (60%), Positives = 37/51 (72%) Frame = +2 Query: 2 FQILPKETESMEHFYSLLPQQMITRAKDVNGGDQTWLREQIQDFLLSDSED 154 FQILPK+ MEHFY LPQ ++TRAK + + + LREQIQD LLSD ED Sbjct: 117 FQILPKDPSLMEHFYLSLPQHLVTRAKRGSSDNLSLLREQIQDCLLSDGED 167