BLASTX nr result
ID: Aconitum21_contig00009689
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00009689 (828 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529299.1| Desacetoxyvindoline 4-hydroxylase, putative ... 63 9e-08 ref|XP_002315713.1| predicted protein [Populus trichocarpa] gi|2... 62 2e-07 ref|XP_002529300.1| Desacetoxyvindoline 4-hydroxylase, putative ... 62 2e-07 ref|XP_002284582.1| PREDICTED: 1-aminocyclopropane-1-carboxylate... 62 2e-07 ref|XP_002306836.1| predicted protein [Populus trichocarpa] gi|2... 60 5e-07 >ref|XP_002529299.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis] gi|223531223|gb|EEF33068.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis] Length = 652 Score = 62.8 bits (151), Expect = 9e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +2 Query: 725 YDRHKELKLFDETKAGVKGLVDDGVTKVPRIFIH 826 YDR ELK+FD+TKAGVKGLVD GVTK+PRIFIH Sbjct: 14 YDRKSELKIFDDTKAGVKGLVDAGVTKIPRIFIH 47 >ref|XP_002315713.1| predicted protein [Populus trichocarpa] gi|222864753|gb|EEF01884.1| predicted protein [Populus trichocarpa] Length = 379 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/49 (61%), Positives = 36/49 (73%) Frame = +2 Query: 680 VGGTTVSPMAELHSDYDRHKELKLFDETKAGVKGLVDDGVTKVPRIFIH 826 VG + ++ + YDR ELK FDETKAGVKGLVD GV+KVP+IFIH Sbjct: 2 VGSGRAAEISVQETSYDRGSELKAFDETKAGVKGLVDAGVSKVPQIFIH 50 >ref|XP_002529300.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis] gi|223531224|gb|EEF33069.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis] Length = 364 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +2 Query: 719 SDYDRHKELKLFDETKAGVKGLVDDGVTKVPRIFIH 826 + YDR ELK FD+TKAGVKGLVD G+TK+PRIFIH Sbjct: 3 TSYDRQSELKAFDDTKAGVKGLVDGGLTKIPRIFIH 38 >ref|XP_002284582.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 1 [Vitis vinifera] Length = 364 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = +2 Query: 695 VSPMAELHSDYDRHKELKLFDETKAGVKGLVDDGVTKVPRIFI 823 V+ +EL DYDR ELK FDE+KAGVKGLVD GV++VPRIFI Sbjct: 3 VTSTSELPGDYDRASELKAFDESKAGVKGLVDAGVSQVPRIFI 45 >ref|XP_002306836.1| predicted protein [Populus trichocarpa] gi|222856285|gb|EEE93832.1| predicted protein [Populus trichocarpa] Length = 374 Score = 60.5 bits (145), Expect = 5e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +2 Query: 719 SDYDRHKELKLFDETKAGVKGLVDDGVTKVPRIFIH 826 S YD+ K +K FDETKAGVKGLVD GVTK+PR FIH Sbjct: 17 SSYDKGKAVKAFDETKAGVKGLVDSGVTKIPRFFIH 52