BLASTX nr result
ID: Aconitum21_contig00009596
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00009596 (477 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526119.1| ubiquitin-protein ligase, putative [Ricinus ... 55 6e-06 >ref|XP_002526119.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223534616|gb|EEF36313.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 414 Score = 55.1 bits (131), Expect = 6e-06 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 7/123 (5%) Frame = +3 Query: 66 NTSLDE-NLGIEIETP---PFDLSTYGSTTLSCNGLVCLVKRRN-LLLVNPTTREYKFVK 230 N +LD N I++E P P D S SCNGL+C + L+NP+TR++K + Sbjct: 70 NVNLDSLNSIIKLENPIKGPTDASHNIKIVGSCNGLLCFGNASGRITLMNPSTRKHKVLP 129 Query: 231 FDNSDHIHGVIEYGKPLDGNVVYGLGYDSVVDEYKLVQMISYKDASTP--DSKILVHSLN 404 F D GK + G +G G DSV D+YK++++ Y D S ++ +V+SL Sbjct: 130 FLRMD----ASVKGKSVWGAWAFGFGCDSVHDDYKVIRLGQYLDFSLQQFETDTMVYSLK 185 Query: 405 DSS 413 +S Sbjct: 186 SNS 188