BLASTX nr result
ID: Aconitum21_contig00009307
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00009307 (351 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEL33272.1| methylenetetrahydrofolate reductase [Nicotiana to... 67 2e-09 gb|AEL33271.1| methylenetetrahydrofolate reductase [Nicotiana to... 67 2e-09 gb|AEL33268.1| methylenetetrahydrofolate reductase [Nicotiana ta... 67 2e-09 ref|XP_003563842.1| PREDICTED: probable methylenetetrahydrofolat... 66 3e-09 gb|AEL33269.1| methylenetetrahydrofolate reductase [Nicotiana sy... 65 4e-09 >gb|AEL33272.1| methylenetetrahydrofolate reductase [Nicotiana tomentosiformis] Length = 595 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -3 Query: 349 EVDSSKTLLEQVQNSYYLVSLVDNDYINGDLFAVFKEL 236 E D S+ LLEQVQNSYYLVSLVDNDYINGDLF++FK++ Sbjct: 558 ETDPSRKLLEQVQNSYYLVSLVDNDYINGDLFSIFKDI 595 >gb|AEL33271.1| methylenetetrahydrofolate reductase [Nicotiana tomentosiformis] Length = 595 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -3 Query: 349 EVDSSKTLLEQVQNSYYLVSLVDNDYINGDLFAVFKEL 236 E D S+ LLEQVQNSYYLVSLVDNDYINGDLF++FK++ Sbjct: 558 ETDPSRKLLEQVQNSYYLVSLVDNDYINGDLFSIFKDI 595 >gb|AEL33268.1| methylenetetrahydrofolate reductase [Nicotiana tabacum] gi|342722659|gb|AEL33270.1| methylenetetrahydrofolate reductase [Nicotiana tomentosiformis] Length = 595 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -3 Query: 349 EVDSSKTLLEQVQNSYYLVSLVDNDYINGDLFAVFKEL 236 E D S+ LLEQVQNSYYLVSLVDNDYINGDLF++FK++ Sbjct: 558 ETDPSRKLLEQVQNSYYLVSLVDNDYINGDLFSIFKDI 595 >ref|XP_003563842.1| PREDICTED: probable methylenetetrahydrofolate reductase-like [Brachypodium distachyon] Length = 594 Score = 65.9 bits (159), Expect = 3e-09 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -3 Query: 349 EVDSSKTLLEQVQNSYYLVSLVDNDYINGDLFAVFKEL 236 E DSSK LLEQVQ SYYLVSLVDNDYI+GDLFA FKE+ Sbjct: 557 EGDSSKELLEQVQKSYYLVSLVDNDYIHGDLFAAFKEI 594 >gb|AEL33269.1| methylenetetrahydrofolate reductase [Nicotiana sylvestris] Length = 595 Score = 65.5 bits (158), Expect = 4e-09 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = -3 Query: 349 EVDSSKTLLEQVQNSYYLVSLVDNDYINGDLFAVFKEL 236 E D S+ LLEQVQNSYYLVSLVDNDYINGDLF++F+++ Sbjct: 558 ETDPSRKLLEQVQNSYYLVSLVDNDYINGDLFSIFQDI 595