BLASTX nr result
ID: Aconitum21_contig00009157
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00009157 (449 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAZ67353.1| chloroplast ferritin [Malus x domestica] 73 3e-11 ref|XP_002277114.1| PREDICTED: ferritin-3, chloroplastic [Vitis ... 72 5e-11 gb|ABD66596.1| iron-binding protein [Pyrus pyrifolia] 71 1e-10 gb|ABD66598.1| iron-binding protein [Pyrus pyrifolia] 70 1e-10 gb|AAB24082.1| ferritin [pea, seed, Peptide Partial, 206 aa] 70 2e-10 >gb|AAZ67353.1| chloroplast ferritin [Malus x domestica] Length = 277 Score = 72.8 bits (177), Expect = 3e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +2 Query: 2 EQVESIKKISEYVAQLRRVGKGHGVWHFDQSLLNG 106 EQVE+IKKISEYVAQLRRVGKGHGVWHFDQ+LLNG Sbjct: 238 EQVEAIKKISEYVAQLRRVGKGHGVWHFDQALLNG 272 >ref|XP_002277114.1| PREDICTED: ferritin-3, chloroplastic [Vitis vinifera] gi|297736556|emb|CBI25427.3| unnamed protein product [Vitis vinifera] Length = 265 Score = 72.0 bits (175), Expect = 5e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +2 Query: 2 EQVESIKKISEYVAQLRRVGKGHGVWHFDQSLLNG 106 EQVE+IKKISEYVAQLRRVGKGHGVWHFDQ LLNG Sbjct: 226 EQVEAIKKISEYVAQLRRVGKGHGVWHFDQMLLNG 260 >gb|ABD66596.1| iron-binding protein [Pyrus pyrifolia] Length = 305 Score = 70.9 bits (172), Expect = 1e-10 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +2 Query: 2 EQVESIKKISEYVAQLRRVGKGHGVWHFDQSLLNG 106 EQVE+IKKISEYVAQLRRVGKGHGVWHFDQ+LL+G Sbjct: 238 EQVEAIKKISEYVAQLRRVGKGHGVWHFDQALLHG 272 >gb|ABD66598.1| iron-binding protein [Pyrus pyrifolia] Length = 307 Score = 70.5 bits (171), Expect = 1e-10 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +2 Query: 2 EQVESIKKISEYVAQLRRVGKGHGVWHFDQSLLN 103 EQVE+IKKISEYVAQLRRVGKGHGVWHFDQ+LLN Sbjct: 274 EQVEAIKKISEYVAQLRRVGKGHGVWHFDQALLN 307 >gb|AAB24082.1| ferritin [pea, seed, Peptide Partial, 206 aa] Length = 206 Score = 70.1 bits (170), Expect = 2e-10 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +2 Query: 2 EQVESIKKISEYVAQLRRVGKGHGVWHFDQSLLNG 106 EQVE+IKKISEYVAQLRRVGKGHGVWHFDQ LL+G Sbjct: 168 EQVEAIKKISEYVAQLRRVGKGHGVWHFDQRLLHG 202