BLASTX nr result
ID: Aconitum21_contig00008900
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00008900 (498 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001154453.1| homolog of anti-oxidant 1 [Arabidopsis thali... 100 1e-19 ref|XP_002888491.1| hypothetical protein ARALYDRAFT_475728 [Arab... 100 1e-19 dbj|BAH57197.1| AT1G66240 [Arabidopsis thaliana] 100 1e-19 ref|NP_564870.1| homolog of anti-oxidant 1 [Arabidopsis thaliana... 100 1e-19 ref|XP_003563850.1| PREDICTED: copper transport protein ATOX1-li... 100 2e-19 >ref|NP_001154453.1| homolog of anti-oxidant 1 [Arabidopsis thaliana] gi|12323573|gb|AAG51766.1|AC066691_6 copper homeostasis factor, putative; 27145-26758 [Arabidopsis thaliana] gi|332196361|gb|AEE34482.1| homolog of anti-oxidant 1 [Arabidopsis thaliana] Length = 66 Score = 100 bits (249), Expect = 1e-19 Identities = 49/57 (85%), Positives = 51/57 (89%) Frame = -3 Query: 496 SCSGCSGAVTRVLTKMEGVESFNVDIKEQKVTVIGNVQPDAVLQTVAKTGKKTAFWE 326 +C GC GAV RVL KMEGVESF+VDIKEQKVTV GNVQPDAVLQTV KTGKKTAFWE Sbjct: 2 TCEGCVGAVKRVLGKMEGVESFDVDIKEQKVTVKGNVQPDAVLQTVTKTGKKTAFWE 58 >ref|XP_002888491.1| hypothetical protein ARALYDRAFT_475728 [Arabidopsis lyrata subsp. lyrata] gi|297334332|gb|EFH64750.1| hypothetical protein ARALYDRAFT_475728 [Arabidopsis lyrata subsp. lyrata] Length = 75 Score = 100 bits (249), Expect = 1e-19 Identities = 49/57 (85%), Positives = 51/57 (89%) Frame = -3 Query: 496 SCSGCSGAVTRVLTKMEGVESFNVDIKEQKVTVIGNVQPDAVLQTVAKTGKKTAFWE 326 +C GC GAV RVL KMEGVESF+VDIKEQKVTV GNVQPDAVLQTV KTGKKTAFWE Sbjct: 12 TCEGCVGAVKRVLGKMEGVESFDVDIKEQKVTVKGNVQPDAVLQTVTKTGKKTAFWE 68 >dbj|BAH57197.1| AT1G66240 [Arabidopsis thaliana] Length = 66 Score = 100 bits (249), Expect = 1e-19 Identities = 49/57 (85%), Positives = 51/57 (89%) Frame = -3 Query: 496 SCSGCSGAVTRVLTKMEGVESFNVDIKEQKVTVIGNVQPDAVLQTVAKTGKKTAFWE 326 +C GC GAV RVL KMEGVESF+VDIKEQKVTV GNVQPDAVLQTV KTGKKTAFWE Sbjct: 2 TCEGCVGAVKRVLGKMEGVESFDVDIKEQKVTVKGNVQPDAVLQTVTKTGKKTAFWE 58 >ref|NP_564870.1| homolog of anti-oxidant 1 [Arabidopsis thaliana] gi|14532548|gb|AAK64002.1| At1g66240/T6J19_6 [Arabidopsis thaliana] gi|18655401|gb|AAL76156.1| At1g66240/T6J19_6 [Arabidopsis thaliana] gi|332196360|gb|AEE34481.1| homolog of anti-oxidant 1 [Arabidopsis thaliana] Length = 106 Score = 100 bits (249), Expect = 1e-19 Identities = 49/57 (85%), Positives = 51/57 (89%) Frame = -3 Query: 496 SCSGCSGAVTRVLTKMEGVESFNVDIKEQKVTVIGNVQPDAVLQTVAKTGKKTAFWE 326 +C GC GAV RVL KMEGVESF+VDIKEQKVTV GNVQPDAVLQTV KTGKKTAFWE Sbjct: 42 TCEGCVGAVKRVLGKMEGVESFDVDIKEQKVTVKGNVQPDAVLQTVTKTGKKTAFWE 98 >ref|XP_003563850.1| PREDICTED: copper transport protein ATOX1-like [Brachypodium distachyon] Length = 83 Score = 99.8 bits (247), Expect = 2e-19 Identities = 48/57 (84%), Positives = 52/57 (91%) Frame = -3 Query: 496 SCSGCSGAVTRVLTKMEGVESFNVDIKEQKVTVIGNVQPDAVLQTVAKTGKKTAFWE 326 SC GC GAV RVL+KMEGVESF+VDIKEQKVTV GNV PDAVLQTV+KTGKKTAFW+ Sbjct: 12 SCEGCVGAVKRVLSKMEGVESFDVDIKEQKVTVKGNVTPDAVLQTVSKTGKKTAFWD 68