BLASTX nr result
ID: Aconitum21_contig00008504
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00008504 (417 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002300747.1| predicted protein [Populus trichocarpa] gi|1... 87 1e-15 ref|NP_175120.1| AAA-type ATPase family protein [Arabidopsis tha... 86 2e-15 ref|XP_002863701.1| regulatory particle triple-a 4A [Arabidopsis... 86 2e-15 ref|NP_001117440.1| AAA-type ATPase family protein [Arabidopsis ... 86 2e-15 ref|XP_003603981.1| 26S proteasome regulatory ATPase subunit S10... 86 2e-15 >ref|XP_002300747.1| predicted protein [Populus trichocarpa] gi|118483383|gb|ABK93592.1| unknown [Populus trichocarpa] gi|222842473|gb|EEE80020.1| predicted protein [Populus trichocarpa] Length = 402 Score = 87.0 bits (214), Expect = 1e-15 Identities = 42/45 (93%), Positives = 42/45 (93%) Frame = +3 Query: 3 EAGMFAIRAERDYVIHEDFMKAVRKLTEAKKLESTAHYNTDFGKD 137 EAGM AIRAERDYVIHEDFMKAVRKL EAKKLESTAHYN DFGKD Sbjct: 358 EAGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESTAHYNADFGKD 402 >ref|NP_175120.1| AAA-type ATPase family protein [Arabidopsis thaliana] gi|297846852|ref|XP_002891307.1| hypothetical protein ARALYDRAFT_891428 [Arabidopsis lyrata subsp. lyrata] gi|75336159|sp|Q9MAK9.1|PS10B_ARATH RecName: Full=26S protease regulatory subunit S10B homolog B; AltName: Full=26S proteasome AAA-ATPase subunit RPT4b; AltName: Full=26S proteasome subunit S10B homolog B; AltName: Full=Regulatory particle triple-A ATPase subunit 4b gi|7767657|gb|AAF69154.1|AC007915_6 F27F5.8 [Arabidopsis thaliana] gi|17065266|gb|AAL32787.1| similar to 26S proteasome AAA-ATPase subunit RPT4a [Arabidopsis thaliana] gi|21387177|gb|AAM47992.1| 26S proteasome AAA-ATPase subunit RPT4a-like protein [Arabidopsis thaliana] gi|297337149|gb|EFH67566.1| hypothetical protein ARALYDRAFT_891428 [Arabidopsis lyrata subsp. lyrata] gi|332193951|gb|AEE32072.1| AAA-type ATPase family protein [Arabidopsis thaliana] Length = 399 Score = 86.3 bits (212), Expect = 2e-15 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = +3 Query: 3 EAGMFAIRAERDYVIHEDFMKAVRKLTEAKKLESTAHYNTDFGKD 137 EAGMFAIRAERDYVIHEDFMKAVRKL+EAKKLES++HYN DFGK+ Sbjct: 355 EAGMFAIRAERDYVIHEDFMKAVRKLSEAKKLESSSHYNADFGKE 399 >ref|XP_002863701.1| regulatory particle triple-a 4A [Arabidopsis lyrata subsp. lyrata] gi|297309536|gb|EFH39960.1| regulatory particle triple-a 4A [Arabidopsis lyrata subsp. lyrata] Length = 400 Score = 86.3 bits (212), Expect = 2e-15 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = +3 Query: 3 EAGMFAIRAERDYVIHEDFMKAVRKLTEAKKLESTAHYNTDFGKD 137 EAGMFAIRAERDYVIHEDFMKAVRKL+EAKKLES++HYN DFGK+ Sbjct: 356 EAGMFAIRAERDYVIHEDFMKAVRKLSEAKKLESSSHYNADFGKE 400 >ref|NP_001117440.1| AAA-type ATPase family protein [Arabidopsis thaliana] gi|332193952|gb|AEE32073.1| AAA-type ATPase family protein [Arabidopsis thaliana] Length = 335 Score = 86.3 bits (212), Expect = 2e-15 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = +3 Query: 3 EAGMFAIRAERDYVIHEDFMKAVRKLTEAKKLESTAHYNTDFGKD 137 EAGMFAIRAERDYVIHEDFMKAVRKL+EAKKLES++HYN DFGK+ Sbjct: 291 EAGMFAIRAERDYVIHEDFMKAVRKLSEAKKLESSSHYNADFGKE 335 >ref|XP_003603981.1| 26S proteasome regulatory ATPase subunit S10b [Medicago truncatula] gi|355493029|gb|AES74232.1| 26S proteasome regulatory ATPase subunit S10b [Medicago truncatula] Length = 402 Score = 86.3 bits (212), Expect = 2e-15 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = +3 Query: 3 EAGMFAIRAERDYVIHEDFMKAVRKLTEAKKLESTAHYNTDFGKD 137 EAGM AIRAERDYVIHEDFMKAVRKLTEAKKLE++AHYN DFGKD Sbjct: 358 EAGMSAIRAERDYVIHEDFMKAVRKLTEAKKLEASAHYNADFGKD 402