BLASTX nr result
ID: Aconitum21_contig00008331
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00008331 (384 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P27484.1|GRP2_NICSY RecName: Full=Glycine-rich protein 2 gi|1... 55 6e-06 >sp|P27484.1|GRP2_NICSY RecName: Full=Glycine-rich protein 2 gi|19743|emb|CAA42622.1| nsGRP-2 [Nicotiana sylvestris] Length = 214 Score = 55.1 bits (131), Expect = 6e-06 Identities = 29/52 (55%), Positives = 40/52 (76%), Gaps = 4/52 (7%) Frame = -3 Query: 382 EDLLVHQS-IRSGGYRSLAEEDSVD---SKGDNGRSKIVDLSGPNDASIQGG 239 EDL VHQS IRS G+RSLAE ++V+ G +GR+K VD++GP+ A++QGG Sbjct: 32 EDLFVHQSGIRSEGFRSLAEGETVEFEVESGGDGRTKAVDVTGPDGAAVQGG 83