BLASTX nr result
ID: Aconitum21_contig00008095
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00008095 (501 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004146015.1| PREDICTED: alpha,alpha-trehalose-phosphate s... 55 6e-06 >ref|XP_004146015.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like [Cucumis sativus] gi|449503652|ref|XP_004162109.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like [Cucumis sativus] Length = 928 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/46 (58%), Positives = 34/46 (73%), Gaps = 5/46 (10%) Frame = +2 Query: 338 FCSELNDTIVEAQLRMRQVPPPLPFIVAVRHYLQ-----YIVGYTS 460 F SELNDT+VEA+LR+RQ PPPLPF A++HY Q I+G+ S Sbjct: 555 FVSELNDTVVEAELRIRQCPPPLPFDNAIKHYEQSTNRLLILGFNS 600