BLASTX nr result
ID: Aconitum21_contig00007340
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00007340 (438 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512485.1| importin alpha, putative [Ricinus communis] ... 118 4e-25 ref|XP_002519178.1| importin alpha, putative [Ricinus communis] ... 118 4e-25 ref|XP_003556535.1| PREDICTED: importin subunit alpha-1-like [Gl... 116 2e-24 ref|XP_003536050.1| PREDICTED: importin subunit alpha-1-like [Gl... 116 2e-24 ref|XP_003533220.1| PREDICTED: importin subunit alpha-1-like [Gl... 116 2e-24 >ref|XP_002512485.1| importin alpha, putative [Ricinus communis] gi|223548446|gb|EEF49937.1| importin alpha, putative [Ricinus communis] Length = 531 Score = 118 bits (296), Expect = 4e-25 Identities = 57/58 (98%), Positives = 58/58 (100%) Frame = +1 Query: 265 EAAWALTNIASGTSENTRVVIDHGAVPIFVRLLASPSDDVREQAVWALGNVAGDSPKC 438 EAAWALTNIASGTSENTRVVIDHGAVPIFV+LLASPSDDVREQAVWALGNVAGDSPKC Sbjct: 135 EAAWALTNIASGTSENTRVVIDHGAVPIFVKLLASPSDDVREQAVWALGNVAGDSPKC 192 >ref|XP_002519178.1| importin alpha, putative [Ricinus communis] gi|223541493|gb|EEF43042.1| importin alpha, putative [Ricinus communis] Length = 488 Score = 118 bits (296), Expect = 4e-25 Identities = 57/58 (98%), Positives = 58/58 (100%) Frame = +1 Query: 265 EAAWALTNIASGTSENTRVVIDHGAVPIFVRLLASPSDDVREQAVWALGNVAGDSPKC 438 EAAWALTNIASGTSENTRVVIDHGAVPIFV+LLASPSDDVREQAVWALGNVAGDSPKC Sbjct: 137 EAAWALTNIASGTSENTRVVIDHGAVPIFVKLLASPSDDVREQAVWALGNVAGDSPKC 194 >ref|XP_003556535.1| PREDICTED: importin subunit alpha-1-like [Glycine max] Length = 532 Score = 116 bits (291), Expect = 2e-24 Identities = 59/76 (77%), Positives = 65/76 (85%), Gaps = 1/76 (1%) Frame = +1 Query: 214 VNQMPTILSRRQTKKL-IEAAWALTNIASGTSENTRVVIDHGAVPIFVRLLASPSDDVRE 390 V++ L R +L EAAWALTNIASGTSENT+VVIDHGAVPIFV+LLASPSDDVRE Sbjct: 119 VSRFVEFLMREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLASPSDDVRE 178 Query: 391 QAVWALGNVAGDSPKC 438 QAVWALGNVAGDSP+C Sbjct: 179 QAVWALGNVAGDSPRC 194 >ref|XP_003536050.1| PREDICTED: importin subunit alpha-1-like [Glycine max] Length = 532 Score = 116 bits (291), Expect = 2e-24 Identities = 59/76 (77%), Positives = 65/76 (85%), Gaps = 1/76 (1%) Frame = +1 Query: 214 VNQMPTILSRRQTKKL-IEAAWALTNIASGTSENTRVVIDHGAVPIFVRLLASPSDDVRE 390 V++ L R +L EAAWALTNIASGTSENT+VVIDHGAVPIFV+LLASPSDDVRE Sbjct: 119 VSRFVEFLMREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLASPSDDVRE 178 Query: 391 QAVWALGNVAGDSPKC 438 QAVWALGNVAGDSP+C Sbjct: 179 QAVWALGNVAGDSPRC 194 >ref|XP_003533220.1| PREDICTED: importin subunit alpha-1-like [Glycine max] Length = 531 Score = 116 bits (290), Expect = 2e-24 Identities = 55/58 (94%), Positives = 58/58 (100%) Frame = +1 Query: 265 EAAWALTNIASGTSENTRVVIDHGAVPIFVRLLASPSDDVREQAVWALGNVAGDSPKC 438 EAAWALTNIASGTSENT+VVIDHGAVPIFV+LL+SPSDDVREQAVWALGNVAGDSPKC Sbjct: 137 EAAWALTNIASGTSENTKVVIDHGAVPIFVKLLSSPSDDVREQAVWALGNVAGDSPKC 194