BLASTX nr result
ID: Aconitum21_contig00006411
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00006411 (561 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF35949.1| hypothetical protein [Coptis japonica] 87 2e-15 sp|P01067.1|IBB2_ARAHY RecName: Full=Bowman-Birk type proteinase... 79 6e-13 gb|AAY59891.1| serine protease inhibitor [Arachis hypogaea] 77 1e-12 ref|XP_003623932.1| Trypsin inhibitor [Medicago truncatula] gi|3... 77 2e-12 prf||0903208A inhibitor,BIII trypsin chymotrypsin 76 3e-12 >dbj|BAF35949.1| hypothetical protein [Coptis japonica] Length = 98 Score = 87.0 bits (214), Expect = 2e-15 Identities = 33/59 (55%), Positives = 39/59 (66%) Frame = -2 Query: 335 CCDSCVCRASIFAECECEDIKSYCPKSCKSCRCTKSIPPQCRCMDVTKDKCPFPDCHKM 159 CC+ C+C SI +C C D+K YC SC +C CT+SIPPQCRC DV D C P C KM Sbjct: 31 CCNQCLCTKSIPPQCRCTDVKEYCHSSCTNCLCTRSIPPQCRCTDVKLDNCAPPSCRKM 89 >sp|P01067.1|IBB2_ARAHY RecName: Full=Bowman-Birk type proteinase inhibitor B-II gi|351444|prf||0908247D inhibitor BII,protease Length = 63 Score = 78.6 bits (192), Expect = 6e-13 Identities = 30/59 (50%), Positives = 38/59 (64%), Gaps = 2/59 (3%) Frame = -2 Query: 338 DCCDSCVC--RASIFAECECEDIKSYCPKSCKSCRCTKSIPPQCRCMDVTKDKCPFPDC 168 DCC +C+C RA + EC C D +CP +C C CT+SIPPQCRC D T+ +CP C Sbjct: 4 DCCSACICDRRAPPYFECTCGDTFDHCPAACNKCVCTRSIPPQCRCTDRTQGRCPLTPC 62 >gb|AAY59891.1| serine protease inhibitor [Arachis hypogaea] Length = 107 Score = 77.4 bits (189), Expect = 1e-12 Identities = 31/58 (53%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = -2 Query: 335 CCDSCVC--RASIFAECECEDIKSYCPKSCKSCRCTKSIPPQCRCMDVTKDKCPFPDC 168 CC+ C+C RA F EC C D +CP SC SC CT+S PPQCRC D T+ +CP +C Sbjct: 48 CCNGCLCDRRAPPFFECVCVDTFDHCPASCNSCVCTRSNPPQCRCTDKTQGRCPVTEC 105 >ref|XP_003623932.1| Trypsin inhibitor [Medicago truncatula] gi|355498947|gb|AES80150.1| Trypsin inhibitor [Medicago truncatula] Length = 86 Score = 76.6 bits (187), Expect = 2e-12 Identities = 33/57 (57%), Positives = 38/57 (66%) Frame = -2 Query: 335 CCDSCVCRASIFAECECEDIKSYCPKSCKSCRCTKSIPPQCRCMDVTKDKCPFPDCH 165 CCDSC C SI +C C DI C +CKSC CTKSIPPQC C D+T D C +P C+ Sbjct: 32 CCDSCPCTKSIPPQCHCTDIGETCHSACKSCLCTKSIPPQCHCADIT-DFC-YPKCN 86 >prf||0903208A inhibitor,BIII trypsin chymotrypsin Length = 61 Score = 76.3 bits (186), Expect = 3e-12 Identities = 30/58 (51%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = -2 Query: 335 CCDSCVC--RASIFAECECEDIKSYCPKSCKSCRCTKSIPPQCRCMDVTKDKCPFPDC 168 CC+ C+C RA + EC C D +CP SC SC CT+S PPQCRC D T+ +CP +C Sbjct: 2 CCNGCLCDRRAPPYFECVCVDTFDHCPASCNSCVCTRSNPPQCRCTDKTQGRCPVTEC 59