BLASTX nr result
ID: Aconitum21_contig00006098
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00006098 (424 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003554900.1| PREDICTED: pentatricopeptide repeat-containi... 65 6e-09 ref|XP_002278719.1| PREDICTED: pentatricopeptide repeat-containi... 64 1e-08 ref|XP_003618546.1| Pentatricopeptide repeat-containing protein ... 63 3e-08 ref|XP_002324074.1| predicted protein [Populus trichocarpa] gi|2... 62 5e-08 >ref|XP_003554900.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15340, mitochondrial-like [Glycine max] Length = 629 Score = 65.1 bits (157), Expect = 6e-09 Identities = 32/54 (59%), Positives = 38/54 (70%) Frame = +1 Query: 1 NTECHVLRSNMYTLAGN*DEAGSLCNVLKTRGLTKVPDMSSIYVEGQVDHLSSG 162 NTE H+L SNMY L G D+A SL VLK RG+ KVP MSSIYV+GQ+ +G Sbjct: 450 NTEYHILLSNMYALCGKADKANSLRKVLKNRGIRKVPGMSSIYVDGQLHRFIAG 503 >ref|XP_002278719.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15340, mitochondrial-like [Vitis vinifera] Length = 632 Score = 63.9 bits (154), Expect = 1e-08 Identities = 33/54 (61%), Positives = 38/54 (70%) Frame = +1 Query: 1 NTECHVLRSNMYTLAGN*DEAGSLCNVLKTRGLTKVPDMSSIYVEGQVDHLSSG 162 NTE H+L SNMY LAG + A SL VLK RG+ KVP MSSI+V GQV S+G Sbjct: 453 NTEYHILLSNMYALAGKQNRANSLRQVLKKRGIKKVPGMSSIHVGGQVHQFSAG 506 >ref|XP_003618546.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355493561|gb|AES74764.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 637 Score = 62.8 bits (151), Expect = 3e-08 Identities = 31/62 (50%), Positives = 42/62 (67%) Frame = +1 Query: 1 NTECHVLRSNMYTLAGN*DEAGSLCNVLKTRGLTKVPDMSSIYVEGQVDHLSSGKAGRT* 180 NTE H++ SNMY L+G ++A SL VLK RG+ KVP MSSIYV+G++ +G T Sbjct: 458 NTEYHIVLSNMYALSGKVEKANSLRQVLKKRGIKKVPGMSSIYVDGKLHQFIAGDKSHTR 517 Query: 181 TN 186 T+ Sbjct: 518 TS 519 >ref|XP_002324074.1| predicted protein [Populus trichocarpa] gi|222867076|gb|EEF04207.1| predicted protein [Populus trichocarpa] Length = 636 Score = 62.0 bits (149), Expect = 5e-08 Identities = 30/54 (55%), Positives = 38/54 (70%) Frame = +1 Query: 1 NTECHVLRSNMYTLAGN*DEAGSLCNVLKTRGLTKVPDMSSIYVEGQVDHLSSG 162 NTE HVL SNMY L G D+A SL +LK++G+ KVP +SSIYV G + S+G Sbjct: 457 NTEYHVLLSNMYVLEGKQDKANSLRQILKSKGIRKVPGVSSIYVGGNIHQFSAG 510