BLASTX nr result
ID: Aconitum21_contig00003753
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00003753 (551 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAZ67146.1| serine hydroxymethyltransferase [Medicago truncat... 63 4e-08 gb|AFK45020.1| unknown [Medicago truncatula] 63 4e-08 ref|XP_003615366.1| Serine hydroxymethyltransferase [Medicago tr... 63 4e-08 emb|CBI19306.3| unnamed protein product [Vitis vinifera] 62 8e-08 ref|XP_002285605.1| PREDICTED: serine hydroxymethyltransferase, ... 62 8e-08 >gb|AAZ67146.1| serine hydroxymethyltransferase [Medicago truncatula] Length = 507 Score = 62.8 bits (151), Expect = 4e-08 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -2 Query: 136 FHQMEKSAALFRPKLIVAGASAYALLYDYARIRK 35 + QMEKSAALFRPKLIVAGASAYA LYDYARIRK Sbjct: 202 YDQMEKSAALFRPKLIVAGASAYARLYDYARIRK 235 >gb|AFK45020.1| unknown [Medicago truncatula] Length = 507 Score = 62.8 bits (151), Expect = 4e-08 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -2 Query: 136 FHQMEKSAALFRPKLIVAGASAYALLYDYARIRK 35 + QMEKSAALFRPKLIVAGASAYA LYDYARIRK Sbjct: 202 YDQMEKSAALFRPKLIVAGASAYARLYDYARIRK 235 >ref|XP_003615366.1| Serine hydroxymethyltransferase [Medicago truncatula] gi|355516701|gb|AES98324.1| Serine hydroxymethyltransferase [Medicago truncatula] Length = 507 Score = 62.8 bits (151), Expect = 4e-08 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -2 Query: 136 FHQMEKSAALFRPKLIVAGASAYALLYDYARIRK 35 + QMEKSAALFRPKLIVAGASAYA LYDYARIRK Sbjct: 202 YDQMEKSAALFRPKLIVAGASAYARLYDYARIRK 235 >emb|CBI19306.3| unnamed protein product [Vitis vinifera] Length = 514 Score = 61.6 bits (148), Expect = 8e-08 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 136 FHQMEKSAALFRPKLIVAGASAYALLYDYARIRK 35 + Q+EKSAALFRPKLIVAGASAYA LYDYARIRK Sbjct: 209 YDQLEKSAALFRPKLIVAGASAYARLYDYARIRK 242 >ref|XP_002285605.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial [Vitis vinifera] Length = 516 Score = 61.6 bits (148), Expect = 8e-08 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 136 FHQMEKSAALFRPKLIVAGASAYALLYDYARIRK 35 + Q+EKSAALFRPKLIVAGASAYA LYDYARIRK Sbjct: 211 YDQLEKSAALFRPKLIVAGASAYARLYDYARIRK 244