BLASTX nr result
ID: Aconitum21_contig00003618
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00003618 (2398 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002886265.1| predicted protein [Arabidopsis lyrata subsp.... 60 2e-06 ref|NP_179466.1| DNA excision repair protein E [Arabidopsis thal... 60 2e-06 ref|XP_002529848.1| DNA repair and recombination protein RAD26, ... 59 8e-06 >ref|XP_002886265.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297332105|gb|EFH62524.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 1181 Score = 60.5 bits (145), Expect = 2e-06 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 2396 KKTEHVLFCSLTIEQRSMYRSFLASSEVEQI*D 2298 KKTEHVLFCSLT+EQRS YR+FLASSEVEQI D Sbjct: 653 KKTEHVLFCSLTVEQRSTYRAFLASSEVEQILD 685 >ref|NP_179466.1| DNA excision repair protein E [Arabidopsis thaliana] gi|4185142|gb|AAD08945.1| putative SNF2/RAD54 family DNA repair and recombination protein [Arabidopsis thaliana] gi|330251711|gb|AEC06805.1| DNA excision repair protein E [Arabidopsis thaliana] Length = 1187 Score = 60.5 bits (145), Expect = 2e-06 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 2396 KKTEHVLFCSLTIEQRSMYRSFLASSEVEQI*D 2298 KKTEHVLFCSLT+EQRS YR+FLASSEVEQI D Sbjct: 655 KKTEHVLFCSLTVEQRSTYRAFLASSEVEQIFD 687 >ref|XP_002529848.1| DNA repair and recombination protein RAD26, putative [Ricinus communis] gi|223530676|gb|EEF32549.1| DNA repair and recombination protein RAD26, putative [Ricinus communis] Length = 1230 Score = 58.5 bits (140), Expect = 8e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 2396 KKTEHVLFCSLTIEQRSMYRSFLASSEVEQI*D 2298 KKTEHVLFCSLT EQRS+YR+FLAS+EVEQI D Sbjct: 671 KKTEHVLFCSLTAEQRSVYRAFLASTEVEQIID 703