BLASTX nr result
ID: Aconitum21_contig00003374
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00003374 (429 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAD00018.1| histone 1 [Malus x domestica] 59 5e-07 sp|P37218.1|H1_SOLLC RecName: Full=Histone H1 gi|424100|gb|AAA50... 59 5e-07 gb|AAC41651.1| histone H1 [Nicotiana tabacum] 57 1e-06 dbj|BAA88671.1| histone H1 [Nicotiana tabacum] 57 1e-06 emb|CBI35178.3| unnamed protein product [Vitis vinifera] 57 1e-06 >dbj|BAD00018.1| histone 1 [Malus x domestica] Length = 146 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = +2 Query: 311 SAHSHPPYLEMITDALVALKDRTGSSPHAISKVIEDKQK 427 SA +HPPY EM+ DA+V LK+RTGSS +AI+K IEDKQK Sbjct: 54 SAPAHPPYEEMVKDAIVTLKERTGSSQYAITKFIEDKQK 92 >sp|P37218.1|H1_SOLLC RecName: Full=Histone H1 gi|424100|gb|AAA50578.1| histone H1 [Solanum lycopersicum] Length = 287 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 320 SHPPYLEMITDALVALKDRTGSSPHAISKVIEDKQK 427 +HPPY EMI DA+V LK+RTGSS HAI+K IE+KQK Sbjct: 55 THPPYFEMIKDAIVTLKERTGSSQHAITKFIEEKQK 90 >gb|AAC41651.1| histone H1 [Nicotiana tabacum] Length = 282 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +2 Query: 320 SHPPYLEMITDALVALKDRTGSSPHAISKVIEDKQK 427 +HP Y EMI DA+V LKD+TGSS HAI+K IEDKQK Sbjct: 58 THPSYFEMIKDAIVTLKDKTGSSQHAITKFIEDKQK 93 >dbj|BAA88671.1| histone H1 [Nicotiana tabacum] Length = 279 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +2 Query: 320 SHPPYLEMITDALVALKDRTGSSPHAISKVIEDKQK 427 +HP Y EMI DA+V LKD+TGSS HAI+K IEDKQK Sbjct: 58 THPSYFEMIKDAIVTLKDKTGSSQHAITKFIEDKQK 93 >emb|CBI35178.3| unnamed protein product [Vitis vinifera] Length = 177 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = +2 Query: 311 SAHSHPPYLEMITDALVALKDRTGSSPHAISKVIEDKQK 427 S +HPP+LEMIT+A+VALK+RTGSS +AI+K IE+K K Sbjct: 55 SPSTHPPFLEMITEAIVALKERTGSSQYAITKFIEEKHK 93