BLASTX nr result
ID: Aconitum21_contig00003218
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00003218 (432 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515854.1| molybdopterin biosynthesis protein, putative... 63 3e-08 ref|XP_002312858.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 >ref|XP_002515854.1| molybdopterin biosynthesis protein, putative [Ricinus communis] gi|223545009|gb|EEF46523.1| molybdopterin biosynthesis protein, putative [Ricinus communis] Length = 668 Score = 62.8 bits (151), Expect = 3e-08 Identities = 27/40 (67%), Positives = 37/40 (92%) Frame = +3 Query: 312 MISMEEALAKVLRVGQRLEPVTVSLHDSFGKILAQDIRAP 431 MIS+E+AL+ +L+V QRL+P+TV LHD+FGK+LA+DIRAP Sbjct: 14 MISVEDALSTILKVAQRLQPITVPLHDAFGKVLAEDIRAP 53 >ref|XP_002312858.1| predicted protein [Populus trichocarpa] gi|222849266|gb|EEE86813.1| predicted protein [Populus trichocarpa] Length = 653 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = +3 Query: 312 MISMEEALAKVLRVGQRLEPVTVSLHDSFGKILAQDIRAP 431 MIS EEAL +L+V QRL PV+V LHD+ GK+LA+DIRAP Sbjct: 1 MISAEEALQTILKVAQRLLPVSVPLHDALGKVLAEDIRAP 40