BLASTX nr result
ID: Aconitum21_contig00002768
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00002768 (363 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003520677.1| PREDICTED: cytochrome P450 76A2-like [Glycin... 112 3e-23 ref|XP_002528653.1| cytochrome P450, putative [Ricinus communis]... 110 1e-22 ref|XP_002528645.1| cytochrome P450, putative [Ricinus communis]... 110 2e-22 ref|XP_002528654.1| cytochrome P450, putative [Ricinus communis]... 109 3e-22 ref|XP_002528652.1| conserved hypothetical protein [Ricinus comm... 108 6e-22 >ref|XP_003520677.1| PREDICTED: cytochrome P450 76A2-like [Glycine max] Length = 516 Score = 112 bits (280), Expect = 3e-23 Identities = 51/67 (76%), Positives = 60/67 (89%) Frame = +1 Query: 1 EFIPFGAGRRMCAGIPLAHRVLHLALGSLLHCFDWELHHSVSPSTVDMRERMGITLRKYI 180 EFIPFGAGRRMCAG+PLAHRVLHL LGSLLH FDWEL V+PST+DMR+++GIT+RK+ Sbjct: 444 EFIPFGAGRRMCAGVPLAHRVLHLVLGSLLHRFDWELDCHVTPSTMDMRDKLGITMRKFQ 503 Query: 181 PLKAMPK 201 PL A+PK Sbjct: 504 PLLAVPK 510 >ref|XP_002528653.1| cytochrome P450, putative [Ricinus communis] gi|223531942|gb|EEF33756.1| cytochrome P450, putative [Ricinus communis] Length = 515 Score = 110 bits (275), Expect = 1e-22 Identities = 47/68 (69%), Positives = 59/68 (86%) Frame = +1 Query: 1 EFIPFGAGRRMCAGIPLAHRVLHLALGSLLHCFDWELHHSVSPSTVDMRERMGITLRKYI 180 E +PFG+GRR+C GIPLAHRVLHLAL SLLHCFDWEL + +P ++DM ER+GIT+RK + Sbjct: 443 ELLPFGSGRRICVGIPLAHRVLHLALASLLHCFDWELGSNSTPESIDMNERLGITVRKLV 502 Query: 181 PLKAMPKK 204 P+KA+PKK Sbjct: 503 PMKAIPKK 510 >ref|XP_002528645.1| cytochrome P450, putative [Ricinus communis] gi|223531934|gb|EEF33748.1| cytochrome P450, putative [Ricinus communis] Length = 502 Score = 110 bits (274), Expect = 2e-22 Identities = 49/68 (72%), Positives = 59/68 (86%) Frame = +1 Query: 1 EFIPFGAGRRMCAGIPLAHRVLHLALGSLLHCFDWELHHSVSPSTVDMRERMGITLRKYI 180 EFIPFGAGRRMCAG+ LAHR+LHL LGSLLH FDWEL +V+P T+DMR+R+G+T+RK Sbjct: 433 EFIPFGAGRRMCAGVSLAHRILHLTLGSLLHHFDWELEANVTPDTLDMRDRLGVTMRKLE 492 Query: 181 PLKAMPKK 204 PL A+PKK Sbjct: 493 PLLAVPKK 500 >ref|XP_002528654.1| cytochrome P450, putative [Ricinus communis] gi|223531943|gb|EEF33757.1| cytochrome P450, putative [Ricinus communis] Length = 514 Score = 109 bits (272), Expect = 3e-22 Identities = 46/68 (67%), Positives = 59/68 (86%) Frame = +1 Query: 1 EFIPFGAGRRMCAGIPLAHRVLHLALGSLLHCFDWELHHSVSPSTVDMRERMGITLRKYI 180 + +PFG+GRR+C GIPLAHRVLHLAL SLLHCFDWEL + +P T+DM ER+GI++RK + Sbjct: 443 QLLPFGSGRRICVGIPLAHRVLHLALASLLHCFDWELGSNSTPETIDMNERLGISVRKLV 502 Query: 181 PLKAMPKK 204 P+KA+PKK Sbjct: 503 PMKAIPKK 510 >ref|XP_002528652.1| conserved hypothetical protein [Ricinus communis] gi|223531941|gb|EEF33755.1| conserved hypothetical protein [Ricinus communis] Length = 187 Score = 108 bits (269), Expect = 6e-22 Identities = 45/68 (66%), Positives = 59/68 (86%) Frame = +1 Query: 1 EFIPFGAGRRMCAGIPLAHRVLHLALGSLLHCFDWELHHSVSPSTVDMRERMGITLRKYI 180 E +PFG+GRR+C GIPLAHR+LH AL SLLHCFDWEL + +P T+DM+ER+GI++RK + Sbjct: 116 ELLPFGSGRRICVGIPLAHRILHPALASLLHCFDWELGSNSTPETIDMKERLGISVRKLV 175 Query: 181 PLKAMPKK 204 P+KA+PKK Sbjct: 176 PMKAIPKK 183