BLASTX nr result
ID: Aconitum21_contig00002756
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00002756 (595 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265030.2| PREDICTED: peptidyl-prolyl cis-trans isomera... 183 2e-44 emb|CAN82436.1| hypothetical protein VITISV_040459 [Vitis vinifera] 183 2e-44 gb|ACJ06186.1| peptidylprolyl isomerase [Ipomoea batatas] 180 2e-43 ref|XP_002514874.1| peptidyl-prolyl cis-trans isomerase, putativ... 179 2e-43 gb|AFW75093.1| putative peptidyl-prolyl cis-trans isomerase fami... 179 4e-43 >ref|XP_002265030.2| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like [Vitis vinifera] gi|296088703|emb|CBI38153.3| unnamed protein product [Vitis vinifera] Length = 262 Score = 183 bits (464), Expect = 2e-44 Identities = 84/97 (86%), Positives = 92/97 (94%) Frame = -1 Query: 595 GTGGKSIYGQAFKDENFKLTHVGPGVVSMANAGPNTNGSQFFICTAKTPWLDQKHVVFGQ 416 GTGGKSIYG+ FKDENFKL HVGPGVVSMANAGPNTNGSQFFICT KTPWLDQ+HVVFGQ Sbjct: 166 GTGGKSIYGRTFKDENFKLAHVGPGVVSMANAGPNTNGSQFFICTVKTPWLDQRHVVFGQ 225 Query: 415 VLEGMDIVRSIESQETDRGDRPRQRVVISGCGEIPIV 305 VLEGMDIV+ +ESQETDRGDRPR++VVIS CGE+P+V Sbjct: 226 VLEGMDIVKLVESQETDRGDRPRKKVVISECGELPMV 262 >emb|CAN82436.1| hypothetical protein VITISV_040459 [Vitis vinifera] Length = 180 Score = 183 bits (464), Expect = 2e-44 Identities = 84/97 (86%), Positives = 92/97 (94%) Frame = -1 Query: 595 GTGGKSIYGQAFKDENFKLTHVGPGVVSMANAGPNTNGSQFFICTAKTPWLDQKHVVFGQ 416 GTGGKSIYG+ FKDENFKL HVGPGVVSMANAGPNTNGSQFFICT KTPWLDQ+HVVFGQ Sbjct: 84 GTGGKSIYGRTFKDENFKLAHVGPGVVSMANAGPNTNGSQFFICTVKTPWLDQRHVVFGQ 143 Query: 415 VLEGMDIVRSIESQETDRGDRPRQRVVISGCGEIPIV 305 VLEGMDIV+ +ESQETDRGDRPR++VVIS CGE+P+V Sbjct: 144 VLEGMDIVKLVESQETDRGDRPRKKVVISECGELPMV 180 >gb|ACJ06186.1| peptidylprolyl isomerase [Ipomoea batatas] Length = 260 Score = 180 bits (456), Expect = 2e-43 Identities = 82/97 (84%), Positives = 89/97 (91%) Frame = -1 Query: 595 GTGGKSIYGQAFKDENFKLTHVGPGVVSMANAGPNTNGSQFFICTAKTPWLDQKHVVFGQ 416 GTGGKSIYG+ FKDENFKL H GPGVVSMANAGPNTNGSQFFICT KTPWLD +HVVFGQ Sbjct: 164 GTGGKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQ 223 Query: 415 VLEGMDIVRSIESQETDRGDRPRQRVVISGCGEIPIV 305 V+EGMD+V+ IESQETDRGDRP+ RVVIS CGE+PIV Sbjct: 224 VIEGMDVVKLIESQETDRGDRPKNRVVISDCGELPIV 260 >ref|XP_002514874.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis] gi|223545925|gb|EEF47428.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis] Length = 256 Score = 179 bits (455), Expect = 2e-43 Identities = 84/96 (87%), Positives = 89/96 (92%) Frame = -1 Query: 595 GTGGKSIYGQAFKDENFKLTHVGPGVVSMANAGPNTNGSQFFICTAKTPWLDQKHVVFGQ 416 GTGGKSIYG+ FKDENFKL H G GVVSMANAGPNTNGSQFFICT KTPWLDQ+HVVFGQ Sbjct: 158 GTGGKSIYGRTFKDENFKLAHTGAGVVSMANAGPNTNGSQFFICTVKTPWLDQRHVVFGQ 217 Query: 415 VLEGMDIVRSIESQETDRGDRPRQRVVISGCGEIPI 308 VLEGMDIV+ IESQETDRGDRPR+RVVIS CGE+PI Sbjct: 218 VLEGMDIVKLIESQETDRGDRPRKRVVISECGELPI 253 >gb|AFW75093.1| putative peptidyl-prolyl cis-trans isomerase family protein [Zea mays] Length = 251 Score = 179 bits (453), Expect = 4e-43 Identities = 82/97 (84%), Positives = 90/97 (92%) Frame = -1 Query: 595 GTGGKSIYGQAFKDENFKLTHVGPGVVSMANAGPNTNGSQFFICTAKTPWLDQKHVVFGQ 416 GTGGKSIYG+ FKDENFKL H GPGVVSMANAGPNTNGSQFFICT KTPWLD +HVVFGQ Sbjct: 155 GTGGKSIYGRTFKDENFKLVHTGPGVVSMANAGPNTNGSQFFICTVKTPWLDGRHVVFGQ 214 Query: 415 VLEGMDIVRSIESQETDRGDRPRQRVVISGCGEIPIV 305 V+EGMDIVR IESQETDRGDRP+++VVIS CGE+P+V Sbjct: 215 VVEGMDIVRLIESQETDRGDRPKKKVVISECGELPVV 251