BLASTX nr result
ID: Aconitum21_contig00002301
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00002301 (432 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q39963.1|PDX1_HEVBR RecName: Full=Probable pyridoxal biosynth... 105 5e-21 ref|XP_002278391.1| PREDICTED: probable pyridoxal biosynthesis p... 105 5e-21 sp|Q9FT25.1|PDX1_PHAVU RecName: Full=Pyridoxal biosynthesis prot... 104 9e-21 gb|ABY75167.1| pyridoxine biosynthesis protein [Arachis diogoi] 103 1e-20 ref|XP_003593782.1| Pyridoxal biosynthesis protein PDX1.3 [Medic... 103 2e-20 >sp|Q39963.1|PDX1_HEVBR RecName: Full=Probable pyridoxal biosynthesis protein PDX1; AltName: Full=Ethylene-inducible protein HEVER gi|1209317|gb|AAA91063.1| ethylene-inducible protein [Hevea brasiliensis] Length = 309 Score = 105 bits (261), Expect = 5e-21 Identities = 50/55 (90%), Positives = 54/55 (98%) Frame = +2 Query: 2 FKSGDPARRARAIVQAVTHYSDPEILADVSCGLGEAMVGINLNDKNVERYANRSE 166 FKSGDPARRARAIVQAVTHYSDP++LA+VSCGLGEAMVGINLNDK VER+ANRSE Sbjct: 255 FKSGDPARRARAIVQAVTHYSDPDMLAEVSCGLGEAMVGINLNDKKVERFANRSE 309 >ref|XP_002278391.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1-like [Vitis vinifera] Length = 309 Score = 105 bits (261), Expect = 5e-21 Identities = 50/55 (90%), Positives = 53/55 (96%) Frame = +2 Query: 2 FKSGDPARRARAIVQAVTHYSDPEILADVSCGLGEAMVGINLNDKNVERYANRSE 166 FKSGDPARRARAIVQAVTHYSDP++LA+VSCGLGEAMVGINLND VERYANRSE Sbjct: 255 FKSGDPARRARAIVQAVTHYSDPDVLAEVSCGLGEAMVGINLNDDKVERYANRSE 309 >sp|Q9FT25.1|PDX1_PHAVU RecName: Full=Pyridoxal biosynthesis protein PDX1; AltName: Full=pvPDX1 gi|10719739|gb|AAG17942.1| putative pyridoxine biosynthetic enzyme [Phaseolus vulgaris] Length = 312 Score = 104 bits (259), Expect = 9e-21 Identities = 50/55 (90%), Positives = 54/55 (98%) Frame = +2 Query: 2 FKSGDPARRARAIVQAVTHYSDPEILADVSCGLGEAMVGINLNDKNVERYANRSE 166 FKSGDPA+RARAIVQAVTHYSDPEILA+VSCGLGEAMVGINL+D NVER+ANRSE Sbjct: 258 FKSGDPAKRARAIVQAVTHYSDPEILAEVSCGLGEAMVGINLSDTNVERFANRSE 312 >gb|ABY75167.1| pyridoxine biosynthesis protein [Arachis diogoi] Length = 85 Score = 103 bits (257), Expect = 1e-20 Identities = 49/55 (89%), Positives = 53/55 (96%) Frame = +2 Query: 2 FKSGDPARRARAIVQAVTHYSDPEILADVSCGLGEAMVGINLNDKNVERYANRSE 166 FKSGDPA+RARAIVQAVTHYSDPE+LA+VSCGLGEAMVGINLND VER+ANRSE Sbjct: 31 FKSGDPAKRARAIVQAVTHYSDPEVLAEVSCGLGEAMVGINLNDDKVERFANRSE 85 >ref|XP_003593782.1| Pyridoxal biosynthesis protein PDX1.3 [Medicago truncatula] gi|72256515|gb|AAZ67140.1| pyridoxine biosynthesis protein [Medicago truncatula] gi|355482830|gb|AES64033.1| Pyridoxal biosynthesis protein PDX1.3 [Medicago truncatula] Length = 314 Score = 103 bits (256), Expect = 2e-20 Identities = 49/55 (89%), Positives = 53/55 (96%) Frame = +2 Query: 2 FKSGDPARRARAIVQAVTHYSDPEILADVSCGLGEAMVGINLNDKNVERYANRSE 166 FKSGDPA+RARAIVQAVTHYSDPEILA+VSCGLGEAMVG+NL D NVER+ANRSE Sbjct: 260 FKSGDPAKRARAIVQAVTHYSDPEILAEVSCGLGEAMVGLNLTDHNVERFANRSE 314