BLASTX nr result
ID: Aconitum21_contig00002039
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00002039 (942 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI24666.3| unnamed protein product [Vitis vinifera] 62 2e-07 ref|XP_002275949.1| PREDICTED: uncharacterized protein LOC100247... 62 2e-07 ref|XP_004157567.1| PREDICTED: uncharacterized LOC101212225 [Cuc... 62 2e-07 ref|XP_004140680.1| PREDICTED: uncharacterized protein LOC101212... 62 2e-07 ref|XP_002330708.1| predicted protein [Populus trichocarpa] gi|2... 58 3e-06 >emb|CBI24666.3| unnamed protein product [Vitis vinifera] Length = 440 Score = 62.4 bits (150), Expect = 2e-07 Identities = 30/49 (61%), Positives = 38/49 (77%) Frame = +2 Query: 284 KLRLEFQFKLELGVRVDLTGKDTQKVFDDVLANLARTAPAVPGFRRQKG 430 K+ +E Q E+ +RVD+ G DTQ+VFD VL NLAR+AP +PGFRRQKG Sbjct: 300 KIVVESQEDDEIQLRVDVAGVDTQRVFDHVLTNLARSAPPIPGFRRQKG 348 >ref|XP_002275949.1| PREDICTED: uncharacterized protein LOC100247585 [Vitis vinifera] Length = 232 Score = 62.4 bits (150), Expect = 2e-07 Identities = 30/49 (61%), Positives = 38/49 (77%) Frame = +2 Query: 284 KLRLEFQFKLELGVRVDLTGKDTQKVFDDVLANLARTAPAVPGFRRQKG 430 K+ +E Q E+ +RVD+ G DTQ+VFD VL NLAR+AP +PGFRRQKG Sbjct: 92 KIVVESQEDDEIQLRVDVAGVDTQRVFDHVLTNLARSAPPIPGFRRQKG 140 >ref|XP_004157567.1| PREDICTED: uncharacterized LOC101212225 [Cucumis sativus] Length = 165 Score = 62.0 bits (149), Expect = 2e-07 Identities = 29/49 (59%), Positives = 40/49 (81%) Frame = +2 Query: 284 KLRLEFQFKLELGVRVDLTGKDTQKVFDDVLANLARTAPAVPGFRRQKG 430 K+ +E + + ++ +RVDLTG +TQKVFD VL NLAR+AP +PGFR+QKG Sbjct: 101 KVVVESEEENKIQLRVDLTGDETQKVFDQVLTNLARSAPPMPGFRKQKG 149 >ref|XP_004140680.1| PREDICTED: uncharacterized protein LOC101212225 [Cucumis sativus] Length = 247 Score = 62.0 bits (149), Expect = 2e-07 Identities = 29/49 (59%), Positives = 40/49 (81%) Frame = +2 Query: 284 KLRLEFQFKLELGVRVDLTGKDTQKVFDDVLANLARTAPAVPGFRRQKG 430 K+ +E + + ++ +RVDLTG +TQKVFD VL NLAR+AP +PGFR+QKG Sbjct: 115 KVVVESEEENKIQLRVDLTGDETQKVFDQVLTNLARSAPPMPGFRKQKG 163 >ref|XP_002330708.1| predicted protein [Populus trichocarpa] gi|222872312|gb|EEF09443.1| predicted protein [Populus trichocarpa] Length = 123 Score = 58.2 bits (139), Expect = 3e-06 Identities = 27/49 (55%), Positives = 39/49 (79%) Frame = +2 Query: 284 KLRLEFQFKLELGVRVDLTGKDTQKVFDDVLANLARTAPAVPGFRRQKG 430 K+ +E Q + ++ VRVDL+G +TQKVF+ L +LAR+AP +PGFRR+KG Sbjct: 29 KIVIESQEEDKMQVRVDLSGDETQKVFNKALTDLARSAPPIPGFRREKG 77