BLASTX nr result
ID: Aconitum21_contig00001923
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00001923 (403 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF35949.1| hypothetical protein [Coptis japonica] 72 5e-11 gb|AAY59891.1| serine protease inhibitor [Arachis hypogaea] 68 9e-10 prf||0903208A inhibitor,BIII trypsin chymotrypsin 67 2e-09 prf||0908247A inhibitor AI,protease 67 2e-09 sp|P01066.1|IBB1_ARAHY RecName: Full=Bowman-Birk type proteinase... 67 2e-09 >dbj|BAF35949.1| hypothetical protein [Coptis japonica] Length = 98 Score = 72.0 bits (175), Expect = 5e-11 Identities = 27/46 (58%), Positives = 32/46 (69%) Frame = +3 Query: 87 ECECEDIKSSCPQSCKSCLCTKSLPPQCRCTDVTRDKCPFPHCHKM 224 +C C D+K C SC +CLCT+S+PPQCRCTDV D C P C KM Sbjct: 44 QCRCTDVKEYCHSSCTNCLCTRSIPPQCRCTDVKLDNCAPPSCRKM 89 >gb|AAY59891.1| serine protease inhibitor [Arachis hypogaea] Length = 107 Score = 67.8 bits (164), Expect = 9e-10 Identities = 26/45 (57%), Positives = 30/45 (66%) Frame = +3 Query: 81 FTECECEDIKSSCPQSCKSCLCTKSLPPQCRCTDVTRDKCPFPHC 215 F EC C D CP SC SC+CT+S PPQCRCTD T+ +CP C Sbjct: 61 FFECVCVDTFDHCPASCNSCVCTRSNPPQCRCTDKTQGRCPVTEC 105 >prf||0903208A inhibitor,BIII trypsin chymotrypsin Length = 61 Score = 66.6 bits (161), Expect = 2e-09 Identities = 25/45 (55%), Positives = 30/45 (66%) Frame = +3 Query: 81 FTECECEDIKSSCPQSCKSCLCTKSLPPQCRCTDVTRDKCPFPHC 215 + EC C D CP SC SC+CT+S PPQCRCTD T+ +CP C Sbjct: 15 YFECVCVDTFDHCPASCNSCVCTRSNPPQCRCTDKTQGRCPVTEC 59 >prf||0908247A inhibitor AI,protease Length = 67 Score = 66.6 bits (161), Expect = 2e-09 Identities = 25/45 (55%), Positives = 30/45 (66%) Frame = +3 Query: 81 FTECECEDIKSSCPQSCKSCLCTKSLPPQCRCTDVTRDKCPFPHC 215 + EC C D CP SC SC+CT+S PPQCRCTD T+ +CP C Sbjct: 21 YFECVCVDTFDHCPASCNSCVCTRSNPPQCRCTDKTQGRCPVTEC 65 >sp|P01066.1|IBB1_ARAHY RecName: Full=Bowman-Birk type proteinase inhibitor A-II; Contains: RecName: Full=Bowman-Birk type proteinase inhibitor A-I; Contains: RecName: Full=Bowman-Birk type proteinase inhibitor B-I; Contains: RecName: Full=Bowman-Birk type proteinase inhibitor B-III gi|351442|prf||0908247B inhibitor AII,protease Length = 70 Score = 66.6 bits (161), Expect = 2e-09 Identities = 25/45 (55%), Positives = 30/45 (66%) Frame = +3 Query: 81 FTECECEDIKSSCPQSCKSCLCTKSLPPQCRCTDVTRDKCPFPHC 215 + EC C D CP SC SC+CT+S PPQCRCTD T+ +CP C Sbjct: 24 YFECVCVDTFDHCPASCNSCVCTRSNPPQCRCTDKTQGRCPVTEC 68