BLASTX nr result
ID: Aconitum21_contig00001922
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00001922 (415 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF35949.1| hypothetical protein [Coptis japonica] 69 4e-10 gb|AAY59891.1| serine protease inhibitor [Arachis hypogaea] 65 7e-09 prf||0903208A inhibitor,BIII trypsin chymotrypsin 64 2e-08 prf||0908247A inhibitor AI,protease 64 2e-08 sp|P01066.1|IBB1_ARAHY RecName: Full=Bowman-Birk type proteinase... 64 2e-08 >dbj|BAF35949.1| hypothetical protein [Coptis japonica] Length = 98 Score = 68.9 bits (167), Expect = 4e-10 Identities = 28/54 (51%), Positives = 33/54 (61%) Frame = +3 Query: 102 ECECEDIKSSCPQSCKSCRCTKSIPPQCRCMDVTKDKCPFPDCHKMA*PALRCL 263 +C C D+K C SC +C CT+SIPPQCRC DV D C P C KM +R L Sbjct: 44 QCRCTDVKEYCHSSCTNCLCTRSIPPQCRCTDVKLDNCAPPSCRKMDIEQVRIL 97 >gb|AAY59891.1| serine protease inhibitor [Arachis hypogaea] Length = 107 Score = 64.7 bits (156), Expect = 7e-09 Identities = 25/45 (55%), Positives = 29/45 (64%) Frame = +3 Query: 96 FTECECEDIKSSCPQSCKSCRCTKSIPPQCRCMDVTKDKCPFPDC 230 F EC C D CP SC SC CT+S PPQCRC D T+ +CP +C Sbjct: 61 FFECVCVDTFDHCPASCNSCVCTRSNPPQCRCTDKTQGRCPVTEC 105 >prf||0903208A inhibitor,BIII trypsin chymotrypsin Length = 61 Score = 63.5 bits (153), Expect = 2e-08 Identities = 24/45 (53%), Positives = 29/45 (64%) Frame = +3 Query: 96 FTECECEDIKSSCPQSCKSCRCTKSIPPQCRCMDVTKDKCPFPDC 230 + EC C D CP SC SC CT+S PPQCRC D T+ +CP +C Sbjct: 15 YFECVCVDTFDHCPASCNSCVCTRSNPPQCRCTDKTQGRCPVTEC 59 >prf||0908247A inhibitor AI,protease Length = 67 Score = 63.5 bits (153), Expect = 2e-08 Identities = 24/45 (53%), Positives = 29/45 (64%) Frame = +3 Query: 96 FTECECEDIKSSCPQSCKSCRCTKSIPPQCRCMDVTKDKCPFPDC 230 + EC C D CP SC SC CT+S PPQCRC D T+ +CP +C Sbjct: 21 YFECVCVDTFDHCPASCNSCVCTRSNPPQCRCTDKTQGRCPVTEC 65 >sp|P01066.1|IBB1_ARAHY RecName: Full=Bowman-Birk type proteinase inhibitor A-II; Contains: RecName: Full=Bowman-Birk type proteinase inhibitor A-I; Contains: RecName: Full=Bowman-Birk type proteinase inhibitor B-I; Contains: RecName: Full=Bowman-Birk type proteinase inhibitor B-III gi|351442|prf||0908247B inhibitor AII,protease Length = 70 Score = 63.5 bits (153), Expect = 2e-08 Identities = 24/45 (53%), Positives = 29/45 (64%) Frame = +3 Query: 96 FTECECEDIKSSCPQSCKSCRCTKSIPPQCRCMDVTKDKCPFPDC 230 + EC C D CP SC SC CT+S PPQCRC D T+ +CP +C Sbjct: 24 YFECVCVDTFDHCPASCNSCVCTRSNPPQCRCTDKTQGRCPVTEC 68