BLASTX nr result
ID: Aconitum21_contig00001885
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00001885 (1367 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534949.1| conserved hypothetical protein [Ricinus comm... 88 3e-19 ref|XP_002527161.1| cytochrome C oxidase, subunit II, putative [... 74 3e-15 ref|YP_004927630.1| hypothetical protein AnruMp28 (mitochondrion... 44 8e-07 >ref|XP_002534949.1| conserved hypothetical protein [Ricinus communis] gi|223524315|gb|EEF27434.1| conserved hypothetical protein [Ricinus communis] Length = 90 Score = 88.2 bits (217), Expect(2) = 3e-19 Identities = 44/46 (95%), Positives = 44/46 (95%) Frame = -2 Query: 268 MPSTRALLATNHSLAGRSGSAFQVRYPNRLLCSTGSLAPSSIFSTA 131 MPSTRALLATNHSLAGR GSAFQVRYPNRLLCSTGSLAPSSI STA Sbjct: 1 MPSTRALLATNHSLAGRLGSAFQVRYPNRLLCSTGSLAPSSILSTA 46 Score = 34.7 bits (78), Expect(2) = 3e-19 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 48 VVRLSQSGLSSRPMFP 1 VVRLSQSGLSSRPMFP Sbjct: 69 VVRLSQSGLSSRPMFP 84 >ref|XP_002527161.1| cytochrome C oxidase, subunit II, putative [Ricinus communis] gi|223533482|gb|EEF35227.1| cytochrome C oxidase, subunit II, putative [Ricinus communis] Length = 139 Score = 74.3 bits (181), Expect(2) = 3e-15 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = +3 Query: 66 CEPPEKQAITASGWSCREPRSKAVEKIEEGARLPVEQRRRLG 191 C+PP+KQ ITAS WSCREPRSKAV+KI+EGARL VEQRR+LG Sbjct: 98 CDPPKKQDITASDWSCREPRSKAVDKIKEGARLLVEQRRQLG 139 Score = 35.0 bits (79), Expect(2) = 3e-15 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +1 Query: 4 KHRPTAEPTLAQPHH 48 KHRPTAE TLAQPHH Sbjct: 81 KHRPTAESTLAQPHH 95 >ref|YP_004927630.1| hypothetical protein AnruMp28 (mitochondrion) [Anomodon rugelii] gi|336089487|gb|AEH99677.1| hypothetical protein AnruMp28 [Anomodon rugelii] Length = 101 Score = 44.3 bits (103), Expect(2) = 8e-07 Identities = 31/67 (46%), Positives = 39/67 (58%), Gaps = 14/67 (20%) Frame = +2 Query: 164 PGGAEETVRITNLKRGARA----------AGERVVSGQ*RPS*WHSSL----RLALEEPR 301 PG AE+ VRIT+LKRGAR +GERVV+ +P + L ALE+P+ Sbjct: 20 PGEAEDMVRITSLKRGARPKLDRPSQAGYSGERVVN---KPIVLNPQLMALASAALEKPQ 76 Query: 302 GTPYRAS 322 GTPYR S Sbjct: 77 GTPYRVS 83 Score = 36.6 bits (83), Expect(2) = 8e-07 Identities = 15/21 (71%), Positives = 19/21 (90%) Frame = +3 Query: 318 QASIRDETPAQGPQFSLGGRT 380 + S RD+TPAQGP+FSLGG+T Sbjct: 81 RVSPRDQTPAQGPKFSLGGKT 101